![Western Blot: UNC119B Antibody [NBP3-17146] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10; Lane 2: RT4; Lane 3: U-251 MG](http://images.novusbio.com/fullsize/UNC119B-Antibody-Western-Blot-NBP3-17146-img0005.jpg "Western Blot: UNC119B Antibody [NBP3-17146] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10; Lane 2: RT4; Lane 3: U-251 MG")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: IRDLETGTVLFEIAKPCVSDQEEDEEEGGGDVDISAGR |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | UNC119B |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence, PFA/Triton X-100 is recommended for fixation/permeabilization. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, pH 7.2, 40% glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | UNC119B |
![Immunocytochemistry/Immunofluorescence: UNC119B Antibody [NBP3-17146] - Staining of human cell line SiHa shows localization to cytosol, mitochondria & cytokinetic bridge.](http://images.novusbio.com/fullsize/UNC119B-Antibody-Immunocytochemistry-Immunofluorescence-NBP3-17146-img0001.jpg "Immunocytochemistry/Immunofluorescence: UNC119B Antibody [NBP3-17146] - Staining of human cell line SiHa shows localization to cytosol, mitochondria & cytokinetic bridge.")
![Immunohistochemistry-Paraffin: UNC119B Antibody [NBP3-17146] - Staining of human skeletal muscle shows low expression as expected.](http://images.novusbio.com/fullsize/UNC119B-Antibody-Immunohistochemistry-Paraffin-NBP3-17146-img0004.jpg "Immunohistochemistry-Paraffin: UNC119B Antibody [NBP3-17146] - Staining of human skeletal muscle shows low expression as expected.")
![Immunohistochemistry-Paraffin: UNC119B Antibody [NBP3-17146] - Analysis in human fallopian tube and skeletal muscle tissues using Anti-UNC119B antibody. Corresponding UNC119B RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/UNC119B-Antibody-Immunohistochemistry-Paraffin-NBP3-17146-img0002.jpg "Immunohistochemistry-Paraffin: UNC119B Antibody [NBP3-17146] - Analysis in human fallopian tube and skeletal muscle tissues using Anti-UNC119B antibody. Corresponding UNC119B RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: UNC119B Antibody [NBP3-17146] - Staining of human fallopian tube shows high expression.](http://images.novusbio.com/fullsize/UNC119B-Antibody-Immunohistochemistry-Paraffin-NBP3-17146-img0003.jpg "Immunohistochemistry-Paraffin: UNC119B Antibody [NBP3-17146] - Staining of human fallopian tube shows high expression.")
![N/A C-Reactive Protein/CRP [Biotin]](https://images.novusbio.com/images2/DATA_CReactive_Protein_DY1707_ELISA_1701.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/DATA_IL6_M6000_ELISA_936.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/IL-6_M6000_ELISA_415.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images/m6000b_mouse-il-6-quantikine-elisa-kit-44202415433118.jpg)
![Flow Cytometry B7-H2/ICOSLG Antibody [Unconjugated]](https://images.novusbio.com/images2/B7-H2_AF165_Flow_Cytometry_8160.jpg)
![Western Blot B7-H2/ICOSLG Antibody [Unconjugated]](https://images.novusbio.com/images2/B7H2_AF165_Western_Blot_20282.jpg)
![Immunohistochemistry DARC Antibody [Unconjugated]](https://images.novusbio.com/images2/DARC_AF6695_Immunohistochemistry_15918.jpg)
![Western Blot DARC Antibody [Unconjugated]](https://images.novusbio.com/images2/DARC_AF6695_Western_Blot_10725.jpg)
![Flow Cytometry DARC Antibody [Unconjugated]](https://images.novusbio.com/images2/DARC_AF6695_Flow_Cytometry_18905.jpg)
![N/A IL-5 [HRP]](https://images.novusbio.com/images2/IL-5_M5000_ELISA_237.jpg)
![N/A IL-5 [HRP]](https://images.novusbio.com/images2/DATA_IL5_M5000_ELISA_935.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")