![Immunocytochemistry/Immunofluorescence: TrkC Antibody [NBP2-55927] - Staining of human cell line U-2 OS shows localization to nucleoli.](http://images.novusbio.com/fullsize/TrkC-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-55927-img0001.jpg "Immunocytochemistry/Immunofluorescence: TrkC Antibody [NBP2-55927] - Staining of human cell line U-2 OS shows localization to nucleoli.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | ICC/IF |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DGSQLPLFRMNISQCDLPEISVSHVNLTVREGDNAVITCNGSGSPLPDVDWIVTGLQSINTHQTNLNWTNVHAINLTLVNVTSEDNGFTLTCI |
| Predicted Species | Mouse (100%), Rat (100%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | NTRK3 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Immunohistochemistry TrkB Antibody [Unconjugated]](https://images.novusbio.com/images2/TrkB_AF1494_Immunohistochemistry_10167.jpg)
![Western Blot TrkB Antibody [Unconjugated]](https://images.novusbio.com/images2/TrkB_AF1494_Western_Blot_23433.jpg)
![Western Blot TrkB Antibody [Unconjugated]](https://images.novusbio.com/images2/TrkB_AF1494_Western_Blot_19007.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for TrkC Antibody (NBP2-55927)Find related products by research area.
|
|
Successful Transplantation of Friedreich Ataxia Induced Pluripotent Stem Cell (iPSC)-Derived Sensory Neurons in Dorsal Root Ganglia of Adult Rodents Jamshed Arslan, Pharm D, PhD The dorsal root ganglia (DRG) are a collection of cell bodies of sensory nerves carrying sensory information – including nociception, mechanoreception and proprioception – from periphera... Read full blog post. |
|
TrkB: Bridging Ontogenesis and Oncogenesis Tropomyosin receptor kinase B (TrkB) is a member of the Trk receptor tyrosine kinases family consisting of TrkA, TrkB and TrkC. The sequence of these family members is highly conserved. Interaction of brain-derived neurotrophic factor (BDNF) with its ... Read full blog post. |
|
TrkB: Docking for Neurotrophins and Beyond. Tropomyosin receptor kinase B (TrkB) is a member of the Trk receptor tyrosine kinases family consisting of TrkA, TrkB and TrkC. The sequence of these family members is highly conserved. TrK's are activated by several neurotrophins, which are small pro... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | NTRK3 |
![N/A BDNF [HRP]](https://images.novusbio.com/images2/DATA_BDNF_DBD00_ELISA_587.jpg)
![N/A BDNF [HRP]](https://images.novusbio.com/images2/DATA_BDNF_DBD00_ELISA_588.jpg)
![N/A BDNF [HRP]](https://images.novusbio.com/images2/BDNF_DBD00_ELISA_36.jpg)
![Immunohistochemistry TrkA Antibody [Unconjugated]](https://images.novusbio.com/images2/TrkA_AF1056_Immunohistochemistry_6672.jpg)
![Western Blot TrkA Antibody [Unconjugated]](https://images.novusbio.com/images2/TrkA_AF1056_Western_Blot_17300.jpg)
![Immunohistochemistry TrkA Antibody [Unconjugated]](https://images.novusbio.com/images/af1056_rat-trka-affinity-purified-polyclonal-ab-8220249503264.jpg)
![Immunohistochemistry NGFR/TNFRSF16/p75NTR Antibody [Unconjugated]](https://images.novusbio.com/images2/NGF_R_AF1157_Immunohistochemistry_6685.jpg)
![Western Blot NGFR/TNFRSF16/p75NTR Antibody [Unconjugated]](https://images.novusbio.com/images2/NGF_R_AF1157_Western_Blot_17941.jpg)
![SDS-PAGE beta-NGF [Unconjugated]](https://images.novusbio.com/images2/beta-NGF_256-GF_321.jpg)
![Bioactivity beta-NGF [Unconjugated]](https://images.novusbio.com/images2/beta-NGF_256-GF_322.jpg)
![Western Blot LEDGF Antibody (762815) [Unconjugated]](https://images.novusbio.com/images2/12543.jpg)
![Immunocytochemistry LEDGF Antibody (762815) [Unconjugated]](https://images.novusbio.com/images2/12613.jpg)
![N/A TNF RII/TNFRSF1B [HRP]](https://images.novusbio.com/images2/TNF_RII_DRT200_ELISA_176.jpg)
![N/A TNF RII/TNFRSF1B [HRP]](https://images.novusbio.com/images2/DATA_TNF_RII_DRT200_ELISA_817.jpg)
![N/A TNF RII/TNFRSF1B [HRP]](https://images.novusbio.com/images2/DATA_TNF_RII_DRT200_ELISA_818.jpg)
![Neutralization Siglec-7/CD328 Antibody [Unconjugated]](https://images.novusbio.com/images2/Siglec-7_AF1138_Block_Neutralize_8760.jpg)
![Neutralization CNTFR alpha Antibody [Unconjugated]](https://images.novusbio.com/images2/CNTF_R_alpha_AF-303-NA_Block_Neutralize_763.jpg)
![Immunohistochemistry Sortilin Antibody [Unconjugated]](https://images.novusbio.com/images2/Sortilin_AF2934_Immunohistochemistry_7161.jpg)
![Western Blot Sortilin Antibody [Unconjugated]](https://images.novusbio.com/images2/Sortilin_AF2934_Western_Blot_19100.jpg)
![Simple Western Sortilin Antibody [Unconjugated]](https://images.novusbio.com/images2/Sortilin_AF2934_Simple_Western_20098.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")