Home » TRIM60 » TRIM60 Proteins » Recombinant Human TRIM60 GST (N-Term) Protein
Novus Biologicals products are now on bio-techne.com

Recombinant Human TRIM60 GST (N-Term) Protein

 Submit a Review

Images

 
(
Enlarge)
12.5% SDS-PAGE Stained with Coomassie Blue.
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Recombinant Human TRIM60 GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-471 of Human TRIM60

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MEFVTALVNLQEESSCPICLEYLKDPVTINCGHNFCRSCLSVSWKDLDDTFPCPVCRFCFPYKSFRRNPQLRNLTEIAKQLQIRRSKRKRQKENAMCEKHNQFLTLFCVKDLEILCTQCSFSTKHQKHYICPIKKAASYHREILEGSLEPLRNNIERVEKVIILQGSKSVELKKKVEYKREEINSEFEQIRLFLQNEQEMILRQIQDEEMNILAKLNENLVELSDYVSTLKHLLREVEGKSVQSNLELLTQAKSMHHKYQNLKCPELFSFRLTKYGFSLPPQYSGLDRIIKPFQVDVILDLNTAHPQLLVSEDRKAVRYERKKRNICYDPRRFYVCPAVLGSQRFSSGRHYWEVEVGNKPKWILGVCQDCLLRNWQDQPSVLGGFWAIGRYMKSGYVASGPKTTQLLPVVKPSKIGIFLDYELGDLSFYNMNDRSILYTFNDCFTEAVWPYFYTGTDSEPLKICSVSDSER
Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
TRIM60
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
81.5 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TRIM60 GST (N-Term) Protein

  • FLJ35882
  • RING finger protein 129MGC119325
  • RING finger protein 33
  • RNF129
  • RNF33
  • tripartite motif containing 60
  • tripartite motif-containing 60
  • tripartite motif-containing protein 60

Background

The protein encoded by this gene contains a RING finger domain, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Human, Mouse, Rat
RelA/NFkB p65 ELISA K ...
NBP2-29661
ELISA Human, Mouse, Rat RelA/NFkB p65 ELISA Kit (Colorimetric)
ELISA Human, Mouse, Rat RelA/NFkB p65 ELISA Kit (Colorimetric)
ELISA Human, Mouse, Rat RelA/NFkB p65 ELISA Kit (Colorimetric)
(95 Publications)
Species: Hu, Mu, Rt
Applications: ELISA
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(807 Publications)
Species: Hu
Applications: BA
TRIM40 Antibody
H00135644-B01P
Immunocytochemistry/ Immunofluorescence TRIM40 Antibody
Western Blot TRIM40 Antibody
Western Blot TRIM40 Antibody
Species: Hu
Applications: ICC/IF, WB
CD40/TNFRSF5
Antibody [Unconjugate
AF632
Agonist Activity CD40/TNFRSF5 Antibody [Unconjugated]
Western Blot CD40/TNFRSF5 Antibody [Unconjugated]
Simple Western CD40/TNFRSF5 Antibody [Unconjugated]
(7 Publications)
Species: Hu
Applications: AgAct, Simple Western, WB
ARHGEF7 Antibody
NBP1-88650
Western Blot ARHGEF7 Antibody
Immunohistochemistry-Paraffin ARHGEF7 Antibody
Immunohistochemistry-Paraffin ARHGEF7 Antibody
Species: Hu
Applications: IHC, IHC-P, KD, WB
GRASP65 Antibody
(OTI5G8)
NBP2-02665
Immunocytochemistry/ Immunofluorescence GRASP65 Antibody (OTI5G8)
Immunocytochemistry/ Immunofluorescence GRASP65 Antibody (OTI5G8)
Flow Cytometry GRASP65 Antibody (OTI5G8)
(3 Reviews)
(2 Publications)
Species: Ca, Hu, Pm, Po, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
TRIM61 Antibody
NBP2-13485
Immunohistochemistry-Paraffin TRIM61 Antibody
Immunocytochemistry/ Immunofluorescence TRIM61 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
TRIM Antibody
[Unconjugated]
AF4708
Western Blot TRIM Antibody [Unconjugated]
Intracellular Staining by Flow Cytometry TRIM Antibody [Unconjugated]
Simple Western TRIM Antibody [Unconjugated]
Species: Hu
Applications: CyTOF-ready, ICFlow, Simple Western, WB
TRIM17 Antibody
(2E11)
H00051127-M01
Sandwich ELISA TRIM17 Antibody (2E11)
Immunocytochemistry/ Immunofluorescence TRIM17 Antibody (2E11)
(2 Publications)
Species: Hu
Applications: ELISA, ICC/IF, PLA, S-ELISA, WB
WNK1 Antibody
[Unconjugated]
AF2849
Western Blot WNK1 Antibody [Unconjugated]
(5 Publications)
Species: Mu, Rt
Applications: WB
Synaptotagmin 1
Antibody (ASV48) [Unc ...
MAB4364
Immunocytochemistry Synaptotagmin 1 Antibody (ASV48) [Unconjugated]
Immunohistochemistry Synaptotagmin 1 Antibody (ASV48) [Unconjugated]
Immunocytochemistry Synaptotagmin 1 Antibody (ASV48) [Unconjugated]
(1 Publication)
Species: Rt
Applications: ICC, IHC, IP, KO, WB
KIF3A Antibody -
BSA Free
NBP3-05030
Immunocytochemistry/ Immunofluorescence KIF3A Antibody - BSA Free
Western Blot KIF3A Antibody - BSA Free
Immunoprecipitation KIF3A Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
ASCC1 Antibody
(OTI6G5)
NBP2-01345
Flow Cytometry ASCC1 Antibody (OTI6G5)
Flow Cytometry ASCC1 Antibody (OTI6G5)
Western Blot ASCC1 Antibody (OTI6G5)
(1 Review)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
RB1 Antibody
(607121) [Unconjugate
MAB6495
Western Blot RB1 Antibody (607121) [Unconjugated]
Immunocytochemistry RB1 Antibody (607121) [Unconjugated]
Simple Western RB1 Antibody (607121) [Unconjugated]
(4 Publications)
Species: Hu
Applications: ICC, Simple Western, WB
NFkB p105/p50
Antibody (2J10D7) - B ...
NB100-56583
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
(1 Review)
(5 Publications)
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
KIF3B Antibody
H00009371-B01P
Western Blot KIF3B Antibody
Western Blot KIF3B Antibody
Western Blot KIF3B Antibody
(1 Publication)
Species: Hu, Rt
Applications: ICC/IF, WB
tropomyosin-3
Antibody (2E4)
H00007170-M02
Sandwich ELISA tropomyosin-3 Antibody (2E4)
Western Blot tropomyosin-3 Antibody (2E4)
Immunohistochemistry-Paraffin tropomyosin-3 Antibody (2E4)
(2 Publications)
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Solo Antibody -
BSA Free
NBP1-76279
Immunofluorescence Solo Antibody - BSA Free
Western Blot Solo Antibody - BSA Free
Immunohistochemistry Solo Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
ARHGEF40 Antibody
NBP1-83864
Western Blot ARHGEF40 Antibody
Immunohistochemistry-Paraffin ARHGEF40 Antibody
Species: Hu
Applications: IHC, IHC-P, WB
Recombinant Human
TRIM60 GST (N-Term) P ...
H00166655-P01
Recombinant Human TRIM60 GST (N-Term) Protein
Species: Hu
Applications: WB, ELISA, MA, AP

Publications for TRIM60 Recombinant Protein (H00166655-P01) (0)

There are no publications for TRIM60 Recombinant Protein (H00166655-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRIM60 Recombinant Protein (H00166655-P01) (0)

There are no reviews for TRIM60 Recombinant Protein (H00166655-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TRIM60 Recombinant Protein (H00166655-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TRIM60 Products

Array H00166655-P01

Research Areas for TRIM60 Recombinant Protein (H00166655-P01)

Find related products by research area.

Blogs on TRIM60

There are no specific blogs for TRIM60, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TRIM60 GST (N-Term) Protein and receive a gift card or discount.


Bioinformatics

Gene Symbol TRIM60