![Western Blot: TRIM29 Antibody [NBP1-88875] - Analysis in human cell line RT-4.](http://images.novusbio.com/fullsize/TRIM29-Antibody-Western-Blot-NBP1-88875-img0013.jpg "Western Blot: TRIM29 Antibody [NBP1-88875] - Analysis in human cell line RT-4.")
| Reactivity | Hu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: GDDKNSNYFSMDSMEGKRSPYAGLQLGAAKKPPVTFAEKGELRKSIFSESRKPTVSIMEPGETRRNSYPRADTGLFSRSKSGSEEVLCDSCIGNKQKAVKSCLVCQASFCELHL |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | TRIM29 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot TRIM Antibody [Unconjugated]](https://images.novusbio.com/images2/TRIM_AF4708_Western_Blot_5528.jpg)
![Intracellular Staining by Flow Cytometry TRIM Antibody [Unconjugated]](https://images.novusbio.com/images2/TRIM_AF4708_Flow_Cytometry_8261.jpg)
![Simple Western TRIM Antibody [Unconjugated]](https://images.novusbio.com/images2/af4708_human-trim-affinity-purified-polyclonal-ab-simple-western-911202293520.jpg)
![Immunohistochemistry TrkB Antibody [Unconjugated]](https://images.novusbio.com/images2/TrkB_AF1494_Immunohistochemistry_10167.jpg)
![Western Blot TrkB Antibody [Unconjugated]](https://images.novusbio.com/images2/TrkB_AF1494_Western_Blot_23433.jpg)
![Western Blot TrkB Antibody [Unconjugated]](https://images.novusbio.com/images2/TrkB_AF1494_Western_Blot_19007.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | TRIM29 |
![Immunocytochemistry/Immunofluorescence: TRIM29 Antibody [NBP1-88875] - Staining of human cell line SiHa shows localization to intermediate filaments.](http://images.novusbio.com/fullsize/TRIM29-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-88875-img0012.jpg "Immunocytochemistry/Immunofluorescence: TRIM29 Antibody [NBP1-88875] - Staining of human cell line SiHa shows localization to intermediate filaments.")
![Immunohistochemistry-Paraffin: TRIM29 Antibody [NBP1-88875] - Staining of human skin shows cytoplasmic positivity in epidermal cells.](http://images.novusbio.com/fullsize/TRIM29-Antibody-Immunohistochemistry-Paraffin-NBP1-88875-img0016.jpg "Immunohistochemistry-Paraffin: TRIM29 Antibody [NBP1-88875] - Staining of human skin shows cytoplasmic positivity in epidermal cells.")
![Western Blot: TRIM29 Antibody [NBP1-88875] - Analysis in human tonsil tissue.](http://images.novusbio.com/fullsize/TRIM29-Antibody-Western-Blot-NBP1-88875-img0007.jpg "Western Blot: TRIM29 Antibody [NBP1-88875] - Analysis in human tonsil tissue.")
![Western Blot: TRIM29 Antibody [NBP1-88875] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://images.novusbio.com/fullsize/TRIM29-Antibody-Western-Blot-NBP1-88875-img0008.jpg "Western Blot: TRIM29 Antibody [NBP1-88875] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.")
![Immunohistochemistry-Paraffin: TRIM29 Antibody [NBP1-88875] - Staining of human esophagus shows high expression.](http://images.novusbio.com/fullsize/TRIM29-Antibody-Immunohistochemistry-Paraffin-NBP1-88875-img0009.jpg "Immunohistochemistry-Paraffin: TRIM29 Antibody [NBP1-88875] - Staining of human esophagus shows high expression.")
![Immunohistochemistry-Paraffin: TRIM29 Antibody [NBP1-88875] - Staining of human stomach shows low expression as expected.](http://images.novusbio.com/fullsize/TRIM29-Antibody-Immunohistochemistry-Paraffin-NBP1-88875-img0010.jpg "Immunohistochemistry-Paraffin: TRIM29 Antibody [NBP1-88875] - Staining of human stomach shows low expression as expected.")
![Immunohistochemistry-Paraffin: TRIM29 Antibody [NBP1-88875] - Staining in human esophagus and stomach tissues using anti-TRIM29 antibody. Corresponding TRIM29 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/TRIM29-Antibody-Immunohistochemistry-Paraffin-NBP1-88875-img0011.jpg "Immunohistochemistry-Paraffin: TRIM29 Antibody [NBP1-88875] - Staining in human esophagus and stomach tissues using anti-TRIM29 antibody. Corresponding TRIM29 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: TRIM29 Antibody [NBP1-88875] - Staining of human placenta shows cytoplasmic positivity in trophoblastic cells.](http://images.novusbio.com/fullsize/TRIM29-Antibody-Immunohistochemistry-Paraffin-NBP1-88875-img0014.jpg "Immunohistochemistry-Paraffin: TRIM29 Antibody [NBP1-88875] - Staining of human placenta shows cytoplasmic positivity in trophoblastic cells.")
![Immunohistochemistry-Paraffin: TRIM29 Antibody [NBP1-88875] - Staining of human prostate shows cytoplasmic positivity in basal layer of glandular cells.](http://images.novusbio.com/fullsize/TRIM29-Antibody-Immunohistochemistry-Paraffin-NBP1-88875-img0015.jpg "Immunohistochemistry-Paraffin: TRIM29 Antibody [NBP1-88875] - Staining of human prostate shows cytoplasmic positivity in basal layer of glandular cells.")
![SDS-PAGE EGF [Unconjugated]](https://images.novusbio.com/images2/EGF_236-EG_234.jpg)
![Bioactivity EGF [Unconjugated]](https://images.novusbio.com/images2/EGF_236EG_1570.jpg)
![Cell Culture EGF [Unconjugated]](https://images.novusbio.com/images/236-eg_recombinant-human-egf-protein-cf-bioactivity-25202394053.jpg)
![Western Blot Neurogranin Antibody [Unconjugated]](https://images.novusbio.com/images2/Neurogranin_AF7947_Western_Blot_13010.jpg)
![Immunohistochemistry Neurogranin Antibody [Unconjugated]](https://images.novusbio.com/images2/Neurogranin_AF7947_Immunohistochemistry_14734.jpg)
![ELISA Neurogranin Antibody [Unconjugated]](https://images.novusbio.com/images2/af7947_human-mouse-rat-neurogranin-affinity-purified-polyclonal-ab-elisa-27102022104024.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")