Home » TRIM27 » TRIM27 Proteins » TRIM27 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

TRIM27 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for TRIM27 Protein (NBP2-13482PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

TRIM27 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TRIM27.

Source: E. coli

Amino Acid Sequence: VEGFKEQIQNQLDHLKRVKDLKKRRRAQGEQARAELLSLTQMEREKIVWEFEQLYHSLKEHEYRLLARLEELDLAIYNSINGAITQFSCNISHLSS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TRIM27
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-13482.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TRIM27 Recombinant Protein Antigen

  • Ret finger proteinRING finger protein 76
  • RFPtripartite motif protein TRIM27
  • RNF76RFP transforming protein
  • tripartite motif containing 27
  • tripartite motif-containing 27
  • Tripartite motif-containing protein 27
  • zinc finger protein RFP

Background

The TRIM27 gene encodes a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This protein localizes to the nuclear matrix. It interacts with the

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Calmodulin 2
Antibody
NBP2-14871
Immunocytochemistry/ Immunofluorescence Calmodulin 2 Antibody
Western Blot Calmodulin 2 Antibody
(1 Publication)
Species: Mu, Rt
Applications: ICC/IF, WB
Calmodulin
Antibody (2D1) - BSA
NB120-2860
Immunocytochemistry/ Immunofluorescence Calmodulin Antibody (2D1) - BSA Free
Immunocytochemistry/ Immunofluorescence Calmodulin Antibody (2D1) - BSA Free
Immunocytochemistry/ Immunofluorescence Calmodulin Antibody (2D1) - BSA Free
(3 Publications)
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Calmodulin 3
Antibody
NBP2-15669
Western Blot Calmodulin 3 Antibody
Western Blot Calmodulin 3 Antibody
Immunohistochemistry Whole-Mount Calmodulin 3 Antibody
(1 Publication)
Species: Mu, Rt, Ze
Applications: IHC-WhMt, IHC, WB
KRIT1 Antibody
NBP2-47405
Immunohistochemistry-Paraffin KRIT1 Antibody
Immunohistochemistry-Paraffin KRIT1 Antibody
Immunohistochemistry-Paraffin KRIT1 Antibody
Species: Hu
Applications: IHC, IHC-P
calmodulin-lysine
N-methyltransferase A ...
NBP2-57496
Immunocytochemistry/ Immunofluorescence calmodulin-lysine N-methyltransferase Antibody
Species: Hu
Applications: ICC/IF
Ret Antibody
[Unconjugated]
AF482
Immunohistochemistry Ret Antibody [Unconjugated]
Western Blot Ret Antibody [Unconjugated]
Immunohistochemistry Ret Antibody [Unconjugated]
(40 Publications)
Species: Mu
Applications: IHC, WB
Nestin Antibody
(196908) [Unconjugate
MAB1259
Immunocytochemistry Nestin Antibody (196908) [Unconjugated]
Intracellular Staining by Flow Cytometry Nestin Antibody (196908) [Unconjugated]
Western Blot Nestin Antibody (196908) [Unconjugated]
(3 Reviews)
(161 Publications)
Species: Hu
Applications: CyTOF-reported, ICC, ICFlow
PML Protein
Antibody - BSA Free
NB100-59787
Western Blot PML Protein Antibody - BSA Free
Immunohistochemistry PML Protein Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence PML Protein Antibody - BSA Free
(1 Review)
(42 Publications)
Species: Hu, Mu
Applications: Flow, IB, ICC/IF, IHC, IHC-P, IP, KD, PLA, WB
Albumin Antibody
(188835) [Unconjugate ...
MAB1455
Simple Western Albumin Antibody (188835) [Unconjugated] - Serum
Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum
Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum
(3 Reviews)
(54 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
GDNF [Unconjugated]
212-GD
Bioactivity GDNF [Unconjugated]
SDS-PAGE GDNF [Unconjugated]
SEC-MALS GDNF [Unconjugated]
(219 Publications)
Species: Hu
Applications: Bind, BA
Cytokeratin 18
Antibody (810811) [Un ...
MAB7619
Simple Western Cytokeratin 18 Antibody (810811) [Unconjugated]
Western Blot Cytokeratin 18 Antibody (810811) [Unconjugated]
Immunocytochemistry Cytokeratin 18 Antibody (810811) [Unconjugated]
(1 Review)
(4 Publications)
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Adenosine
Deaminase/ADA Antibod
NBP1-87404
Immunohistochemistry-Paraffin Adenosine Deaminase/ADA Antibody
Immunohistochemistry-Paraffin Adenosine Deaminase/ADA Antibody
Immunocytochemistry/ Immunofluorescence Adenosine Deaminase/ADA Antibody
(4 Publications)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, KD, WB
Tyrosine
Hydroxylase Antibody
NB300-109
Immunohistochemistry-Frozen Tyrosine Hydroxylase Antibody
Immunohistochemistry Tyrosine Hydroxylase Antibody
Immunohistochemistry Tyrosine Hydroxylase Antibody
(7 Reviews)
(232 Publications)
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
Thyroglobulin
Antibody (2H11 + 6E1)
NBP2-34294
Immunohistochemistry-Paraffin Thyroglobulin Antibody (2H11 + 6E1)
Immunohistochemistry Thyroglobulin Antibody (2H11 + 6E1)
Immunohistochemistry-Paraffin Thyroglobulin Antibody (2H11 + 6E1)
(3 Reviews)
(1 Publication)
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
Properdin Antibody
AF8216
Western Blot Properdin Antibody
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB
EGFR Antibody
[Unconjugated]
AF231
Immunohistochemistry EGFR Antibody [Unconjugated]
Immunocytochemistry EGFR Antibody [Unconjugated]
Western Blot EGFR Antibody [Unconjugated]
(30 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
TRIM Antibody
[Unconjugated]
AF4708
Western Blot TRIM Antibody [Unconjugated]
Intracellular Staining by Flow Cytometry TRIM Antibody [Unconjugated]
Simple Western TRIM Antibody [Unconjugated]
Species: Hu
Applications: CyTOF-ready, ICFlow, Simple Western, WB
Sialin/SLC17A5
Antibody
NBP2-20383
Immunohistochemistry-Paraffin Sialin/SLC17A5 Antibody
Western Blot Sialin/SLC17A5 Antibody
Immunocytochemistry/ Immunofluorescence Sialin/SLC17A5 Antibody
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NHE6/SLC9A6
Antibody
NBP2-38877
Immunocytochemistry/ Immunofluorescence NHE6/SLC9A6 Antibody
Immunohistochemistry-Paraffin NHE6/SLC9A6 Antibody
Immunohistochemistry-Paraffin NHE6/SLC9A6 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
TRIM27 Recombinant
Protein Antigen
NBP2-13482PEP
TRIM27 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for TRIM27 Protein (NBP2-13482PEP) (0)

There are no publications for TRIM27 Protein (NBP2-13482PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRIM27 Protein (NBP2-13482PEP) (0)

There are no reviews for TRIM27 Protein (NBP2-13482PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for TRIM27 Protein (NBP2-13482PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TRIM27 Products

Blogs on TRIM27

There are no specific blogs for TRIM27, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

10x Magnification cryo-sections mouse: primary antibody: anti-rb TH: 1:500; o.n. secondary antibody: 1:500 dk-anti-rb DyLight488. IHC-Fr image submitted by a verified customer review.
Tyrosine Hydroxylase Antibody
NB300-109

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our TRIM27 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol TRIM27