Novus Biologicals products are now on bio-techne.com

TRAF-5 Recombinant Protein Antigen

Images

 
There are currently no images for TRAF-5 Protein (NBP1-87121PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

TRAF-5 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TRAF5.

Source: E. coli

Amino Acid Sequence: NAKVILGRYQQDHLQQCLFQPVQCSNEKCREPVLRKDLKEHLSASCQFRKEKCLYCKKDVVVINLQNHEENLCPEYPVFCPNNCAKIILKTEVDEHLAVCPEAEQDCPFKHYGCAVTDKR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TRAF5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87121.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.

Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TRAF-5 Recombinant Protein Antigen

  • MGC:39780
  • RNF84
  • RNF84RING finger protein 84
  • TNF receptor-associated factor 5
  • TRAF5
  • TRAF-5

Background

The TRAF (TNF receptor-associated factor) family is a group of adapter proteins (TRAFs 1-6) that link a wide variety of cell surface receptors to diverse signaling cascades leading to the activation of NF-kB and mitogen-activated protein kinases (reviewed in Chung et al, 2002). TRAFs are major signal transducers for both the TNF and IL- 1/TLR receptor superfamilies and collectively play important functions in both adaptive and innate immunity. The carboxy-terminal region of TRAFs is required for self-association and interaction with receptor cytoplasmic domains following ligand-induced oligomerization. TRAFs interact with a variety of proteins that regulate receptor-induced cell death or survival, and TRAF-mediated signaling can promote cell survival or interfere with death receptor-induced apoptosis. IMG-5765 recognizes TRAF5. Mouse TRAF5 is a 558 amino acid protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56173
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP2-26506
Species: Hu, Mu, Rt
Applications: B/N, In vitro
NB100-56144
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NB100-56176
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
NB100-56170
Species: Bv, Ca, Hu
Applications: IHC, IHC-P, IP, WB
AF632
Species: Hu
Applications: AgAct, Simple Western, WB
MAB17761
Species: Hu, Mu, Rt
Applications: ICC, WB
NB100-56508
Species: Av, Hu, Mu, Rt
Applications: CyTOF-ready, Flow-CS, Flow, IHC, IHC-P, WB
NB100-56177
Species: Bv, Hu, Mu, Rt, Ze
Applications: IHC, IHC-P, IP, WB
MAB8930
Species: Hu
Applications: ICC, Simple Western, WB
462-TR
Species: Mu
Applications: BA
DCDL40
Species: Hu
Applications: ELISA
NBP2-29661
Species: Hu, Mu, Rt
Applications: ELISA
NBP2-46157
Species: Hu
Applications: Flow, IHC, IHC-P, WB
NBP2-23603
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
H00009448-M07
Species: Bv, Hu, Pa
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NB100-56704
Species: Hu, Mu, Pm, Rt
Applications: ChIP, ChIP, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
NB100-56077
Species: Hu
Applications: IHC, IHC-P, IP, WB

Publications for TRAF-5 Protein (NBP1-87121PEP) (0)

There are no publications for TRAF-5 Protein (NBP1-87121PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRAF-5 Protein (NBP1-87121PEP) (0)

There are no reviews for TRAF-5 Protein (NBP1-87121PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for TRAF-5 Protein (NBP1-87121PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TRAF-5 Products

Research Areas for TRAF-5 Protein (NBP1-87121PEP)

Find related products by research area.

Blogs on TRAF-5

There are no specific blogs for TRAF-5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our TRAF-5 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TRAF5