Home » TPD52L1/D53 » TPD52L1/D53 Proteins » TPD52L1/D53 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

TPD52L1/D53 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for TPD52L1/D53 Protein (NBP1-84314PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

TPD52L1/D53 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TPD52L1.

Source: E. coli

Amino Acid Sequence: SPTFKSFEERVETTVTSLKTKVGGTNPNGGSFEEVLSSTAHASAQSLAGGSRRTKEEELQC

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TPD52L1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84314.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.
Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TPD52L1/D53 Recombinant Protein Antigen

  • D53
  • MGC8556
  • tumor protein D52-like 1hD53TPD52L2
  • tumor protein D52-like 2
  • tumor protein D53

Background

TPD52L1/D53 encodes a member of the tumor protein D52 (TPD52) family. The encoded protein contains a coiled-coil domain and may form homo- or hetero-dimer with TPD52 family members. The protein is reported to be involved in cell proliferation and calcium signaling. It also interacts with the mitogen-activated protein kinase kinase kinase 5 (MAP3K5/ASK1) and positively regulates MAP3K5-induced apoptosis. Multiple alternatively spliced transcript variants have been observed, but the full-length nature of some variants has not yet been determined. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

TPD52 Antibody
NBP2-38952
Immunohistochemistry-Paraffin TPD52 Antibody
Immunohistochemistry-Paraffin TPD52 Antibody
Immunohistochemistry-Paraffin TPD52 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
TPD52L2/D54
Antibody
NBP2-13468
Western Blot TPD52L2/D54 Antibody
Immunohistochemistry-Paraffin TPD52L2/D54 Antibody
Immunocytochemistry/ Immunofluorescence TPD52L2/D54 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
14-3-3 Antibody
NBP2-27202
Simple Western 14-3-3 Antibody
Immunocytochemistry/ Immunofluorescence 14-3-3 Antibody
Western Blot 14-3-3 Antibody
(1 Review)
Species: Ca, Ch, ChHa, Fe, Hu, Mu, Ma-Op, Po, Pm, Rt
Applications: ICC/IF, Simple Western, WB
Recombinant Human
MAL2 GST (N-Term) Pro ...
H00114569-P01
Other Recombinant Human MAL2 GST (N-Term) Protein
Species: Hu
Applications: ELISA, AP, PA, WB
TPD52L3/D55
Antibody (OTI8C12) - ...
NBP2-74567
Western Blot TPD52L3/D55 Antibody (OTI8C12) - Azide and BSA Free
Flow Cytometry TPD52L3/D55 Antibody (OTI8C12) - Azide and BSA Free
Immunohistochemistry TPD52L3/D55 Antibody (OTI8C12) - Azide and BSA Free
Species: Hu
Applications: CyTOF-ready, Flow, IHC, WB
Cyclin B1 Antibody
[Unconjugated]
AF6000
Immunohistochemistry Cyclin B1 Antibody [Unconjugated]
Western Blot Cyclin B1 Antibody [Unconjugated]
Simple Western Cyclin B1 Antibody [Unconjugated]
(12 Publications)
Species: Hu, Mu
Applications: IHC, Simple Western, WB
Tyrosine
Hydroxylase Antibody
NB300-109
Immunohistochemistry-Frozen Tyrosine Hydroxylase Antibody
Immunohistochemistry Tyrosine Hydroxylase Antibody
Immunohistochemistry Tyrosine Hydroxylase Antibody
(7 Reviews)
(230 Publications)
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
14-3-3 beta/alpha
Antibody
NBP1-80611
Immunohistochemistry-Paraffin 14-3-3 beta/alpha Antibody
Immunohistochemistry-Paraffin 14-3-3 beta/alpha Antibody
Immunohistochemistry-Paraffin 14-3-3 beta/alpha Antibody
(3 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Syntaxin 1A
Antibody (2B2F10)
NBP3-15706
Immunohistochemistry-Paraffin Syntaxin 1A Antibody (2B2F10)
Immunohistochemistry Syntaxin 1A Antibody (2B2F10)
Immunohistochemistry Syntaxin 1A Antibody (2B2F10)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Neurotrimin/HNT
Antibody [Unconjugate
AF1235
Neurotrimin/HNT Antibody [Unconjugated]
(2 Publications)
Species: Hu
Applications: IHC, WB
CXCL6/GCP-2
Antibody (60910)
MAB333
Neutralization CXCL6/GCP-2 Antibody (60910)
(1 Review)
(3 Publications)
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), Neut, WB
Androgen R/NR3C4
[p Ser213, p Ser210] ...
NB100-56603
Western Blot Androgen R/NR3C4 [p Ser213, p Ser210] Antibody (156C135.2) - BSA Free
(14 Publications)
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
Catalase Antibody
[Unconjugated]
AF3398
Western Blot Catalase Antibody [Unconjugated]
Simple Western Catalase Antibody [Unconjugated]
Knockout Validated Catalase Antibody [Unconjugated]
(3 Reviews)
(15 Publications)
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
Glutathione S
Transferase kappa 1 A ...
NBP2-16686
Western Blot Glutathione S Transferase kappa 1 Antibody
Western Blot Glutathione S Transferase kappa 1 Antibody
Immunohistochemistry-Paraffin Glutathione S Transferase kappa 1 Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KO, WB
CD36 Antibody -
BSA Free
NB400-144
Western Blot CD36 Antibody - BSA Free
Immunohistochemistry CD36 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence CD36 Antibody - BSA Free
(9 Reviews)
(128 Publications)
Species: Av, Bv, Hu, Mu, Po, Pm, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
ISLR Antibody
NBP2-14131
Immunohistochemistry-Paraffin ISLR Antibody
Immunohistochemistry-Paraffin ISLR Antibody
Immunohistochemistry-Paraffin ISLR Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P
MxA/Mx1 Antibody
NBP1-32905
Immunohistochemistry-Paraffin MxA/Mx1 Antibody
Western Blot MxA/Mx1 Antibody
Western Blot MxA/Mx1 Antibody
(1 Review)
(1 Publication)
Species: Bv, Hu, Pm, Rb
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
TPD52L1/D53
Recombinant Protein A
NBP1-84314PEP
TPD52L1/D53 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for TPD52L1/D53 Protein (NBP1-84314PEP) (0)

There are no publications for TPD52L1/D53 Protein (NBP1-84314PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TPD52L1/D53 Protein (NBP1-84314PEP) (0)

There are no reviews for TPD52L1/D53 Protein (NBP1-84314PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for TPD52L1/D53 Protein (NBP1-84314PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TPD52L1/D53 Products

Research Areas for TPD52L1/D53 Protein (NBP1-84314PEP)

Find related products by research area.

Blogs on TPD52L1/D53

There are no specific blogs for TPD52L1/D53, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

10x Magnification cryo-sections mouse: primary antibody: anti-rb TH: 1:500; o.n. secondary antibody: 1:500 dk-anti-rb DyLight488. IHC-Fr image submitted by a verified customer review.
Tyrosine Hydroxylase Antibody
NB300-109
Western Blot: CD36 Antibody [NB400-144] - Mouse primary muscle cell lysate. Western blot image submitted by a verified customer review.
CD36 Antibody - BSA Free
NB400-144

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our TPD52L1/D53 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol TPD52L1