![Immunohistochemistry-Paraffin: 14-3-3 beta/alpha Antibody [NBP1-80611] - Analysis in human cerebral cortex and pancreas tissues. Corresponding YWHAB RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/14-3-3-beta-alpha-Antibody-Immunohistochemistry-Paraffin-NBP1-80611-img0006.jpg "Immunohistochemistry-Paraffin: 14-3-3 beta/alpha Antibody [NBP1-80611] - Analysis in human cerebral cortex and pancreas tissues. Corresponding YWHAB RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: ICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKE |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | YWHAB |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Western_Blot_5930.jpg)
![Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/16332.jpg)
![Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Flow_Cytometry_8283.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for 14-3-3 beta/alpha Antibody (NBP1-80611)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot: 14-3-3 beta/alpha Antibody [NBP1-80611] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp](http://images.novusbio.com/fullsize/14-3-3-beta-alpha-Antibody-Western-Blot-NBP1-80611-img0005.jpg "Western Blot: 14-3-3 beta/alpha Antibody [NBP1-80611] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp")
![Immunocytochemistry/Immunofluorescence: 14-3-3 beta/alpha Antibody [NBP1-80611] - Staining of human cell line A-431 shows positivity in cytoplasm. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/14-3-3-beta-alpha-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-80611-img0003.jpg "Immunocytochemistry/Immunofluorescence: 14-3-3 beta/alpha Antibody [NBP1-80611] - Staining of human cell line A-431 shows positivity in cytoplasm. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: 14-3-3 beta/alpha Antibody [NBP1-80611] - Staining of human pancreas shows very weak positivity in exocrine glandular cells as expected.](http://images.novusbio.com/fullsize/14-3-3-beta-alpha-Antibody-Immunohistochemistry-Paraffin-NBP1-80611-img0010.jpg "Immunohistochemistry-Paraffin: 14-3-3 beta/alpha Antibody [NBP1-80611] - Staining of human pancreas shows very weak positivity in exocrine glandular cells as expected.")
![Western Blot: 14-3-3 beta/alpha Antibody [NBP1-80611] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).](http://images.novusbio.com/fullsize/14-3-3-beta-alpha-Antibody-Western-Blot-NBP1-80611-img0004.jpg "Western Blot: 14-3-3 beta/alpha Antibody [NBP1-80611] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).")
![Immunohistochemistry-Paraffin: 14-3-3 beta/alpha Antibody [NBP1-80611] - Staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neurons.](http://images.novusbio.com/fullsize/14-3-3-beta-alpha-Antibody-Immunohistochemistry-Paraffin-NBP1-80611-img0007.jpg "Immunohistochemistry-Paraffin: 14-3-3 beta/alpha Antibody [NBP1-80611] - Staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neurons.")
![Immunohistochemistry-Paraffin: 14-3-3 beta/alpha Antibody [NBP1-80611] - Staining of human cerebellum shows moderate to strong cytoplasmic positivity in Purkinje cells.](http://images.novusbio.com/fullsize/14-3-3-beta-alpha-Antibody-Immunohistochemistry-Paraffin-NBP1-80611-img0008.jpg "Immunohistochemistry-Paraffin: 14-3-3 beta/alpha Antibody [NBP1-80611] - Staining of human cerebellum shows moderate to strong cytoplasmic positivity in Purkinje cells.")
![Immunohistochemistry-Paraffin: 14-3-3 beta/alpha Antibody [NBP1-80611] - Staining of human skin shows moderate to strong cytoplasmic positivity in epidermal cells.](http://images.novusbio.com/fullsize/14-3-3-beta-alpha-Antibody-Immunohistochemistry-Paraffin-NBP1-80611-img0009.jpg "Immunohistochemistry-Paraffin: 14-3-3 beta/alpha Antibody [NBP1-80611] - Staining of human skin shows moderate to strong cytoplasmic positivity in epidermal cells.")
![Western Blot Lyn Antibody [Unconjugated]](https://images.novusbio.com/images2/Lyn_AF3206_Western_Blot_5256.jpg)
![Simple Western Lyn Antibody [Unconjugated]](https://images.novusbio.com/images2/Lyn_AF3206_Simple_Western_21252.jpg)
![Immunocytochemistry Lyn Antibody [Unconjugated]](https://images.novusbio.com/images2/Lyn_AF3206_Immunocytochemistry_9784.jpg)
![Western Blot Src [p Tyr419] Antibody [Unconjugated]](https://images.novusbio.com/images2/Src_AF2685_Western_Blot_5209.jpg)
![Simple Western Src [p Tyr419] Antibody [Unconjugated]](https://images.novusbio.com/images2/16327.jpg)
![Immunohistochemistry Src [p Tyr419] Antibody [Unconjugated]](https://images.novusbio.com/images2/Src_AF2685_Immunohistochemistry_7158.jpg)
![Simple Western Vav-1 [p Tyr160] Antibody (751411) [Unconjugated]](https://images.novusbio.com/images2/Vav1_MAB37861_Simple_Western_16683.jpg)
![Western Blot Vav-1 [p Tyr160] Antibody (751411) [Unconjugated]](https://images.novusbio.com/images2/Vav-1_MAB37861_Western_Blot_12193.jpg)
![Immunocytochemistry Vav-1 [p Tyr160] Antibody (751411) [Unconjugated]](https://images.novusbio.com/images2/Vav-1_MAB37861_Immunocytochemistry_12236.jpg)
![N/A Erythropoietin/EPO [HRP]](https://images.novusbio.com/images2/DATA_Erythropoietin_MEP00_ELISA_970.jpg)
![N/A Erythropoietin/EPO [HRP]](https://images.novusbio.com/images2/Erythropoietin_MEP00_ELISA_421.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")