![Western Blot: Torsin A Antibody [NBP2-85973] - Host: Rabbit. Target Name: TOR1A. Sample Type: Stomach Tumor lysates. Antibody Dilution: 1.0ug/ml](http://images.novusbio.com/fullsize/Torsin-A-Antibody-Western-Blot-NBP2-85973-img0001.jpg "Western Blot: Torsin A Antibody [NBP2-85973] - Host: Rabbit. Target Name: TOR1A. Sample Type: Stomach Tumor lysates. Antibody Dilution: 1.0ug/ml")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Concentration | 0.5 mg/ml |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human Torsin A. Peptide sequence: FWRSGKQREDIKLKDIEHALSVSVFNNKNSGFWHSSLIDRNLIDYFVPFL The peptide sequence for this immunogen was taken from within the described region. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | TOR1A |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for Torsin A Antibody (NBP2-85973)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | TOR1A |
![Neutralization TRAILR1/TNFRSF10A Antibody [Unconjugated]](https://images.novusbio.com/images2/TRAIL_R1_AF347_Block_Neutralize_875.jpg)
![Western Blot TRAILR1/TNFRSF10A Antibody [Unconjugated]](https://images.novusbio.com/images2/TRAIL_R1_AF347_Western_Blot_5303.jpg)
![Immunohistochemistry TRAILR1/TNFRSF10A Antibody [Unconjugated]](https://images.novusbio.com/images2/TRAIL_R1_AF347_Immunohistochemistry_17355.jpg)
![Western Blot Transglutaminase 2/TGM2 Antibody [Unconjugated]](https://images.novusbio.com/images2/Transglutaminase_2_AF4376_Western_Blot_11080.jpg)
![Simple Western Transglutaminase 2/TGM2 Antibody [Unconjugated]](https://images.novusbio.com/images2/Transglutaminase_2_AF4376_Simple_Western_17620.jpg)
![Knockout Validated Transglutaminase 2/TGM2 Antibody [Unconjugated]](https://images.novusbio.com/images/af4376_human-mouse-rat-transglutaminase-2-tgm2-aff-purified-pab-20820241518569.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Simple Western PKR Antibody (HL71/10) [Unconjugated]](https://images.novusbio.com/images2/PKR_MAB1980_Simple_Western_20723.jpg)
![Immunocytochemistry PKR Antibody (HL71/10) [Unconjugated]](https://images.novusbio.com/images2/PKR_MAB1980_Immunocytochemistry_9844.jpg)
![Western Blot PKR Antibody (HL71/10) [Unconjugated]](https://images.novusbio.com/images2/PKR_MAB1980_Western_Blot_20507.jpg)
![Bioactivity CTLA-4 [Unconjugated]](https://images.novusbio.com/images2/CTLA4_7268CT_2293.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")