![Recombinant Human TOR/mTOR Protein [H00002475-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.](http://images.novusbio.com/fullsize/qc_test-H00002475-Q01-1.jpg "Recombinant Human TOR/mTOR Protein [H00002475-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, MA, AP |
| Description | A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1521-1620 of Human TOR/mTOR Source: Wheat Germ (in vitro) Amino Acid Sequence: WGLGQWDSMEEYTCMIPRDTHDGAFYRAVLALHQDLFSLAQQCIDKARDLLDAELTAMAGESYSRAYGAMVSCHMLSELEEVIQYKLVPERREIIRQIWW |
| Preparation Method |
in vitro wheat germ expression system |
| Details of Functionality | This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated. |
| Source | Wheat germ |
| Protein/Peptide Type | Recombinant Protein |
| Gene | MTOR |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
| Dilutions |
|
|
| Theoretical MW | 36.63 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
|
| Publications |
|
| Storage | Store at -80C. Avoid freeze-thaw cycles. |
| Buffer | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
| Preservative | No Preservative |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
![Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Western_Blot_5930.jpg)
![Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/16332.jpg)
![Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Flow_Cytometry_8283.jpg)
![Western Blot PTEN Antibody [Unconjugated]](https://images.novusbio.com/images2/PTEN_AF847_Western_Blot_5922.jpg)
![Simple Western PTEN Antibody [Unconjugated]](https://images.novusbio.com/images2/16342.jpg)
![Knockout Validated PTEN Antibody [Unconjugated]](https://images.novusbio.com/images2/PTEN_AF847_Knockout_Validated_22996.jpg)
![Immunohistochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunohistochemistry_20892.jpg)
![Immunocytochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunocytochemistry__Immunofluorescence_21143.jpg)
![Western Blot EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Western_Blot_19925.jpg)
Research Areas for TOR/mTOR Partial Recombinant Protein (H00002475-Q01)Find related products by research area.
|
|
Staufen1 Overabundance and the Consequent mTOR Hyperactivity in Amyotrophic Lateral Sclerosis, Spinocerebellar Ataxia Type 2, Alzheimer’s, Parkinson’s, and Huntington’s Diseases Jamshed Arslan, Pharm D, PhD Neurodegenerative disorders involve loss of function and, ultimately, death of neurons. Selective neuronal vulnerability has been observed in a variety of neurodegenerative diseases. Fo... Read full blog post. |
|
mTOR Signaling and the Tumor Microenvironment By Yoskaly Lazo-Fernandez, PhD The mammalian target of rapamycin (mTOR) is a conserved serine/threonine kinase that, as a member of two distinct intracellular protein complexes, mTORC1 and mTORC2, regulates protein ... Read full blog post. |
|
The Many Connections Between Autophagy and Kidney Disease By Yoskaly Lazo-Fernandez, PhD The first description of what is called today an autophagosome was given in a paper published in 1957. Its author employed electron microscopy to observe the neonatal features of mous... Read full blog post. |
|
Thomson Reuters Predicts 2016 Nobel Prize Winners Here at Bio-Techne we always look forward to the annual announcements of winners of the highly coveted Nobel Prize – the greatest award in science. How can you go about predicting which scientists might be in line for a life-changing phone-call fro... Read full blog post. |
|
mTOR - a central regulator of cell metabolism The mammalian target of rapamycin (mTOR) signaling pathway allows cells to monitor environmental signals like nutrient availability and oxygen levels. mTOR is a phosphoinositide 3-kinase (PI3K)-related protein that assembles into large protein comp... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | MTOR |
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_871.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_872.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/VEGF_DVE00_ELISA_208.jpg)
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![Simple Western PYK2/FAK2 [p Tyr402] Antibody (592918) [Unconjugated]](https://images.novusbio.com/images2/PYK2_MAB6210_Simple_Western_16639.jpg)
![Western Blot PYK2/FAK2 [p Tyr402] Antibody (592918) [Unconjugated]](https://images.novusbio.com/images2/PYK2_MAB6210_Western_Blot_9430.jpg)
![Western Blot eIF4E [p Ser209] Antibody](https://images.novusbio.com/images/eIF4E-[p-Ser209]-Antibody-Western-Blot-NB100-81898-img0009.jpg)
![Immunocytochemistry/ Immunofluorescence eIF4E [p Ser209] Antibody](https://images.novusbio.com/images/eIF4E-[p-Ser209]-Antibody-Immunocytochemistry-Immunofluorescence-NB100-81898-img0005.jpg)
![Immunohistochemistry-Paraffin eIF4E [p Ser209] Antibody](https://images.novusbio.com/images/eIF4E-[p-Ser209]-Antibody-Immunohistochemistry-NB100-81898-img0006.jpg)
![Immunohistochemistry-Paraffin: TOR/mTOR [p Ser2448] Antibody [NB600-607] - Brown arrow= IBa1 positive cells, Green arrow= mTOR positive cells, Black arrow= mTOR and IBA1 positive cells. IHC-P Image submitted by a verified customer review.](https://images.novusbio.com/images/TOR-mTOR-[p-Ser2448]-Antibody-Immunohistochemistry-Paraffin-NB600-607-img0005.jpg "Immunohistochemistry-Paraffin: TOR/mTOR [p Ser2448] Antibody [NB600-607] - Brown arrow= IBa1 positive cells, Green arrow= mTOR positive cells, Black arrow= mTOR and IBA1 positive cells. IHC-P Image submitted by a verified customer review.")