Home » TOPORS » TOPORS Proteins » TOPORS Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

TOPORS Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for TOPORS Protein (NBP2-39060PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

TOPORS Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TOPORS.

Source: E. coli

Amino Acid Sequence: IVQHIIMSNVTRYDLESQAFVSDLRPFLLNRTEHFIHEFISFARSPFNMAAFDQHANYDCPAPSYEEGSHSDSSVITISPDEAETQELDINVATVSQAPWDDETPGPSYSSSEQVHVTMSSLL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TOPORS
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-39060.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TOPORS Recombinant Protein Antigen

  • EC 6.3.2.-
  • LUNtopoisomerase I binding, arginine/serine-rich
  • p53-binding protein 3
  • p53BP3
  • retinitis pigmentosa 31 (autosomal dominant)
  • RP31
  • SUMO1-protein E3 ligase Topors
  • topoisomerase I binding, arginine/serine-rich, E3 ubiquitin protein ligase
  • Topoisomerase I-binding arginine/serine-rich protein
  • Topoisomerase I-binding RING finger protein
  • TP53BPLE3 ubiquitin-protein ligase Topors
  • Tumor suppressor p53-binding protein 3

Background

TOPORS functions as an ubiquitin-protein E3 ligase and as an E3 SUMO1-protein ligase. Can both ubiquitinate and sumoylate p53

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

FoxF2 Antibody
AF6988
Western Blot FoxF2 Antibody
(5 Publications)
Species: Hu
Applications: WB
p53 Antibody (PAb
240) - BSA Free
NB200-103
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow (Intracellular) p53 Antibody (PAb 240) - BSA Free
(3 Reviews)
(42 Publications)
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
FoxF1 Antibody
[Unconjugated]
AF4798
Western Blot FoxF1 Antibody [Unconjugated]
Western Blot FoxF1 Antibody [Unconjugated]
Western Blot FoxF1 Antibody [Unconjugated]
(29 Publications)
Species: Hu
Applications: WB
SCN11A Antibody
NBP1-82600
Immunohistochemistry-Paraffin SCN11A Antibody
Species: Hu
Applications: IHC, IHC-P
PML Protein
Antibody - BSA Free
NB100-59787
Western Blot PML Protein Antibody - BSA Free
Immunohistochemistry PML Protein Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence PML Protein Antibody - BSA Free
(1 Review)
(42 Publications)
Species: Hu, Mu
Applications: Flow, IB, ICC/IF, IHC, IHC-P, IP, KD, PLA, WB
E-Cadherin
Antibody [Unconjugate
AF748
Immunocytochemistry E-Cadherin Antibody [Unconjugated]
Immunohistochemistry E-Cadherin Antibody [Unconjugated]
Immunocytochemistry E-Cadherin Antibody [Unconjugated]
(143 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, ICC, IHC, Simple Western, WB
MUL1 Antibody
(5H6.2D5) - BSA Free
NBP2-31361
Western Blot MUL1 Antibody (5H6.2D5) - BSA Free
Immunohistochemistry-Paraffin MUL1 Antibody (5H6.2D5) - BSA Free
Immunohistochemistry-Paraffin MUL1 Antibody (5H6.2D5) - BSA Free
Species: Hu
Applications: IHC, IHC-P, WB
p21/CIP1/CDKN1A
Antibody (WA-1)
NBP2-29463
Immunohistochemistry-Paraffin p21/CIP1/CDKN1A Antibody (WA-1)
(24 Publications)
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Park7/DJ-1 Antibody
NB300-270
Immunohistochemistry-Paraffin Park7/DJ-1 Antibody
Western Blot Park7/DJ-1 Antibody
Western Blot Park7/DJ-1 Antibody
(3 Reviews)
(23 Publications)
Species: Ch, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, In vitro, Simple Western, WB
MDM2/HDM2 Antibody
(SMP14) - BSA Free
NB100-2736
Western Blot MDM2/HDM2 Antibody (SMP14) - BSA Free
Immunohistochemistry-Paraffin MDM2/HDM2 Antibody (SMP14) - BSA Free
Immunohistochemistry-Paraffin MDM2/HDM2 Antibody (SMP14) - BSA Free
(1 Review)
(22 Publications)
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
ZNF645 Antibody
NBP2-21037
Western Blot ZNF645 Antibody
Immunohistochemistry-Paraffin ZNF645 Antibody
Species: Hu
Applications: IHC, IHC-P, WB
PLK1 Antibody
(OTI1D4)
NBP1-48291
Western Blot PLK1 Antibody (OTI1D4)
Immunohistochemistry-Paraffin PLK1 Antibody (OTI1D4)
Immunohistochemistry-Paraffin PLK1 Antibody (OTI1D4)
(1 Review)
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IP, WB
TRIM50 Antibody
NBP1-81988
Immunohistochemistry-Paraffin TRIM50 Antibody
Species: Hu
Applications: IHC, IHC-P
DBT Antibody
NBP1-89522
Immunocytochemistry/ Immunofluorescence DBT Antibody
Immunohistochemistry-Paraffin DBT Antibody
Immunohistochemistry-Paraffin DBT Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
HNF-3 alpha/FoxA1
Antibody (3B11NB) - B ...
NBP2-45269
Flow Cytometry HNF-3 alpha/FoxA1 Antibody (3B11NB) - BSA Free
Western Blot HNF-3 alpha/FoxA1 Antibody (3B11NB) - BSA Free
Flow Cytometry HNF-3 alpha/FoxA1 Antibody (3B11NB) - BSA Free
(2 Publications)
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
RNF2 Antibody (6C2)
H00006045-M01
Western Blot RNF2 Antibody (6C2)
Western Blot RNF2 Antibody (6C2)
Sandwich ELISA RNF2 Antibody (6C2)
(4 Publications)
Species: Hu, I, Mu
Applications: ELISA, ICC/IF, KD, S-ELISA, WB

Publications for TOPORS Protein (NBP2-39060PEP) (0)

There are no publications for TOPORS Protein (NBP2-39060PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TOPORS Protein (NBP2-39060PEP) (0)

There are no reviews for TOPORS Protein (NBP2-39060PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for TOPORS Protein (NBP2-39060PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TOPORS Products

Array NBP2-39060PEP

Research Areas for TOPORS Protein (NBP2-39060PEP)

Find related products by research area.

Blogs on TOPORS

There are no specific blogs for TOPORS, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Flow Cytometry: p53 Antibody (PAb 240) [NB200-103] - An intracellular stain was performed on HeLa cells with p53 (PAb240) NB200-103AF647 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
p53 Antibody (PAb 240) - BSA Free
NB200-103

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our TOPORS Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol TOPORS