Home » Thimet Oligopeptidase/THOP1 » Thimet Oligopeptidase/THOP1 Proteins » Thimet Oligopeptidase/THOP1 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Thimet Oligopeptidase/THOP1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Thimet Oligopeptidase/THOP1 Recombinant Protein Antigen (NBP2-55258PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Thimet Oligopeptidase/THOP1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to Thimet Oligopeptidase/THOP1.

Source: E. coli

Amino Acid Sequence: AACAGDMADAASPCSVVNDLRWDLSAQQIEERTRELIEQTKRVYDQVGTQEFEDVSYESTLKA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
THOP1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55258.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking tide related information and a protocol, click here.
Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Thimet Oligopeptidase/THOP1 Recombinant Protein Antigen

  • EC 3.4.24
  • EC 3.4.24.15
  • Endopeptidase 24.15
  • EP24.15
  • MEPD_HUMAN
  • MP78
  • thimet oligopeptidase 1
  • thimet oligopeptidase
  • THOP1
  • TOP

Background

Thimet oligopeptidase, a widely distributed enzyme in most species, plays a role in the metabolism of short neuropeptides (under 20 a.a. residues long). Thimet Oligopeptidase has an influential role in cytoplasmic peptide degradation. Other functions of Thimet Oligopeptidase include the degradation of amyloid precursor protein and the production of amyloidogenic fragments.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Glutaminyl-peptide
Cyclotransferase/QPCT ...
NBP1-81838
Western Blot Glutaminyl-peptide Cyclotransferase/QPCT Antibody
Immunohistochemistry Glutaminyl-peptide Cyclotransferase/QPCT Antibody
Immunohistochemistry-Paraffin Glutaminyl-peptide Cyclotransferase/QPCT Antibody
(1 Publication)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Kininogen Antibody
NBP1-89993
Immunohistochemistry-Paraffin Kininogen Antibody
Immunohistochemistry-Paraffin Kininogen Antibody
Western Blot Kininogen Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
ACE/CD143 Antibody
[Unconjugated]
AF1513
Immunohistochemistry ACE/CD143 Antibody [Unconjugated]
Western Blot ACE/CD143 Antibody [Unconjugated]
Simple Western ACE/CD143 Antibody [Unconjugated]
(1 Review)
(7 Publications)
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
Neurotensin
Antibody
NBP2-33903
Immunohistochemistry-Paraffin Neurotensin Antibody
Immunohistochemistry-Paraffin Neurotensin Antibody
Immunohistochemistry-Paraffin Neurotensin Antibody
Species: Hu
Applications: IHC, IHC-P
Neurolysin
Antibody (OTI1D6) - A ...
NBP2-72961
Western Blot Neurolysin Antibody (OTI1D6) - Azide and BSA Free
Western Blot Neurolysin Antibody (OTI1D6) - Azide and BSA Free
Flow Cytometry Neurolysin Antibody (OTI1D6) - Azide and BSA Free
Species: Hu, Pm, Mu, Pm, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC, WB
Neprilysin/CD10
Antibody [Unconjugate
AF1126
Immunohistochemistry Neprilysin/CD10 Antibody [Unconjugated]
Western Blot Neprilysin/CD10 Antibody [Unconjugated]
Western Blot Neprilysin/CD10 Antibody [Unconjugated]
(22 Publications)
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
Ribosomal Protein
S6/RPS6 [p Ser235, p ...
AF3918
Western Blot Ribosomal Protein S6/RPS6 [p Ser235, p Ser236] Antibody [Unconjugated]
Simple Western Ribosomal Protein S6/RPS6 [p Ser235, p Ser236] Antibody [Unconjugated]
Immunohistochemistry Ribosomal Protein S6/RPS6 [p Ser235, p Ser236] Antibody [Unconjugated]
(6 Publications)
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
Prolyl
Oligopeptidase/PREP A
NBP2-33950
Immunocytochemistry/ Immunofluorescence Prolyl Oligopeptidase/PREP Antibody
Immunohistochemistry-Paraffin Prolyl Oligopeptidase/PREP Antibody
Immunohistochemistry-Paraffin Prolyl Oligopeptidase/PREP Antibody
(3 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
TOR/mTOR [p
Ser2448] Antibody
NB600-607
Immunohistochemistry-Paraffin TOR/mTOR [p Ser2448] Antibody
Western Blot TOR/mTOR [p Ser2448] Antibody
Data TOR/mTOR [p Ser2448] Antibody
(2 Reviews)
(9 Publications)
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, WB
Serpin
A8/Angiotensinogen An ...
NBP1-30027
Immunohistochemistry-Paraffin Serpin A8/Angiotensinogen Antibody - BSA Free
Western Blot Serpin A8/Angiotensinogen Antibody - BSA Free
Immunohistochemistry-Paraffin Serpin A8/Angiotensinogen Antibody - BSA Free
(11 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Erythropoietin/EPO
[HRP]
MEP00B
N/A Erythropoietin/EPO [HRP]
N/A Erythropoietin/EPO [HRP]
(104 Publications)
Species: Mu
Applications: ELISA
Tyrosinase
Antibody (JA52-11)
NBP2-67232
Immunocytochemistry/ Immunofluorescence Tyrosinase Antibody (JA52-11)
Immunocytochemistry/ Immunofluorescence Tyrosinase Antibody (JA52-11)
Immunohistochemistry-Paraffin Tyrosinase Antibody (JA52-11)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
ACBP Antibody -
Azide and BSA Free
NBP2-92856
Western Blot ACBP Antibody - Azide and BSA Free
Western Blot ACBP Antibody - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence ACBP Antibody - Azide and BSA Free
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Aminopeptidase
N/CD13 Antibody [Unco ...
AF2335
Immunocytochemistry Aminopeptidase N/CD13 Antibody [Unconjugated]
Immunohistochemistry Aminopeptidase N/CD13 Antibody [Unconjugated]
(53 Publications)
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, IP, WB
GnRH Antibody
NB300-506
Immunohistochemistry-Paraffin GnRH Antibody
Immunohistochemistry-Paraffin GnRH Antibody
(2 Publications)
Species: Am, Mu
Applications: ICC/IF, IHC, IHC-P
Catalase Antibody
[Unconjugated]
AF3398
Western Blot Catalase Antibody [Unconjugated]
Simple Western Catalase Antibody [Unconjugated]
Knockout Validated Catalase Antibody [Unconjugated]
(3 Reviews)
(15 Publications)
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
ATP Citrate Lyase
Antibody
NBP1-90267
Immunocytochemistry/ Immunofluorescence ATP Citrate Lyase Antibody
Western Blot ATP Citrate Lyase Antibody
Western Blot ATP Citrate Lyase Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Thimet
Oligopeptidase/THOP1 ...
NBP2-55258PEP
Thimet Oligopeptidase/THOP1 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for Thimet Oligopeptidase/THOP1 Recombinant Protein Antigen (NBP2-55258PEP) (0)

There are no publications for Thimet Oligopeptidase/THOP1 Recombinant Protein Antigen (NBP2-55258PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Thimet Oligopeptidase/THOP1 Recombinant Protein Antigen (NBP2-55258PEP) (0)

There are no reviews for Thimet Oligopeptidase/THOP1 Recombinant Protein Antigen (NBP2-55258PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Thimet Oligopeptidase/THOP1 Recombinant Protein Antigen (NBP2-55258PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Thimet Oligopeptidase/THOP1 Products

Research Areas for Thimet Oligopeptidase/THOP1 Recombinant Protein Antigen (NBP2-55258PEP)

Find related products by research area.

Blogs on Thimet Oligopeptidase/THOP1

There are no specific blogs for Thimet Oligopeptidase/THOP1, but you can read our latest blog posts.

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Thimet Oligopeptidase/THOP1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol THOP1