![Western Blot: SUN1 Antibody [H00023353-B01P] - Analysis of UNC84A expression in transfected 293T cell line by UNC84A polyclonal antibody. Lane 1: UNC84A transfected lysate(28.38 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/SUN1-Antibody-Western-Blot-H00023353-B01P-img0003.jpg "Western Blot: SUN1 Antibody [H00023353-B01P] - Analysis of UNC84A expression in transfected 293T cell line by UNC84A polyclonal antibody. Lane 1: UNC84A transfected lysate(28.38 KDa). Lane 2: Non-transfected lysate.")
| Reactivity | Hu, Mu, HaSpecies Glossary |
| Applications | WB, ICC/IF |
| Clonality | Polyclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | UNC84A (AAH13613, 1 a.a. - 257 a.a.) full-length human protein. MDFSRLHMYSPPQCVPENTGYTYALSSSYSSDALDFETEHKLDPVFDSPRMSRRSLRLATTACTLGDGEAVGADSGTSSAVSLKNRAARTTKQRRSTNKSAFSINHVSRQVTSSGVSHGGTVSLQDAVTRRPPVLDESWIREQTTVDHFWGLDDDGDLKGGSKAAIQGNGDVGAAAATAHNGFSCSNCSMLSERKDVLTAHPAPPGPVSRVYSRDRNQKCKSQSFKTQKKVCFPNLIFPFCKSQCLHYLSWRLKIIP |
| Specificity | UNC84A - unc-84 homolog A (C. elegans), |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Mouse |
| Gene | SUN1 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. |
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | IgG purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for SUN1 Antibody (H00023353-B01P)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![N/A Neutrophil Elastase/ELA2 [Biotin]](https://images.novusbio.com/images2/DATA_Neutrophil_Elastase_DY451705_ELISA_2461.jpg)
![Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]](https://images.novusbio.com/images/Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP1-97019-img0004.jpg "Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]")