![Western Blot: SR1 Antibody [NBP2-88360] - WB Suggested Anti-SRI Antibody. Titration: 1.0 ug/ml. Positive Control: Jurkat Whole Cell](http://images.novusbio.com/fullsize/SR1-Antibody-Western-Blot-NBP2-88360-img0001.jpg "Western Blot: SR1 Antibody [NBP2-88360] - WB Suggested Anti-SRI Antibody. Titration: 1.0 ug/ml. Positive Control: Jurkat Whole Cell")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Concentration | 0.5 mg/ml |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of SR1. Peptide sequence: KELWAVLNGWRQHFISFDTDRSGTVDPQELQKALTTMGFRLSPQAVNSIA The peptide sequence for this immunogen was taken from within the described region. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SRI |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for SRI Antibody (NBP2-88360)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SRI |
![SDS-PAGE LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_719.jpg)
![Bioactivity LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_721.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Immunocytochemistry Integrin alpha 2/CD49b Antibody (HAS3) [Unconjugated]](https://images.novusbio.com/images2/Integrin_alpha_2_MAB1233_Immunocytochemistry__Immunofluorescence_19196.jpg)
![Flow Cytometry Integrin alpha 2/CD49b Antibody (HAS3) [Unconjugated]](https://images.novusbio.com/images2/Integrin_alpha_2_MAB1233_Flow_Cytometry_19476.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")