![Immunohistochemistry-Paraffin: SLMAP Antibody [NBP1-81397] - Immunohistochemistry analysis in human smooth muscle and liver tissues using Anti-SLMAP antibody. Corresponding SLMAP RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/SLMAP-Antibody-Immunohistochemistry-NBP1-81397-img0023.jpg "Immunohistochemistry-Paraffin: SLMAP Antibody [NBP1-81397] - Immunohistochemistry analysis in human smooth muscle and liver tissues using Anti-SLMAP antibody. Corresponding SLMAP RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SEYEKEITSLQNSFQLRCQQCEDQQREEATRLQGELEKLRKEWNALETECHSLKRENVLLSSELQRQEKELHNSQKQSLELTSDLSILQMSRKELENQVGSLKEQHLRDSADLKTLLSKAENQAKDVQKEYEKTQTVLSELKLKFEMTEQ |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SLMAP |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot FYB/ADAP/SLAP130 Antibody [Unconjugated]](https://images.novusbio.com/images2/SLAP-130_AF3857_Western_Blot_5357.jpg)
![Simple Western SLP-76/LCP2 [p Tyr145] Antibody (776503) [Unconjugated]](https://images.novusbio.com/images2/SLP76_MAB7474_Simple_Western_16628.jpg)
![Western Blot SLP-76/LCP2 [p Tyr145] Antibody (776503) [Unconjugated]](https://images.novusbio.com/images2/SLP-76_MAB7474_Western_Blot_12293.jpg)
![Immunocytochemistry SLP-76/LCP2 [p Tyr145] Antibody (776503) [Unconjugated]](https://images.novusbio.com/images2/SLP-76_MAB7474_Immunocytochemistry_12318.jpg)
| Publication using NBP1-81397 | Applications | Species |
|---|---|---|
| Mlynarova, J;Trentin-Sonoda, M;Gaisler da Silva, F;Major, JL;Salih, M;Carneiro-Ramos, MS;Tuana, BS; SLMAP3 isoform modulates cardiac gene expression and function PLoS ONE 2019-04-01 [PMID: 30934005] (WB, Mouse) | WB | Mouse |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SLMAP |
![Immunohistochemistry-Paraffin: SLMAP Antibody [NBP1-81397] - Staining of human liver, lymph node, smooth muscle and testis using Anti-SLMAP antibody NBP1-81397 (A) shows similar protein distribution across tissues to independent antibody NBP1-81398 (B).](http://images.novusbio.com/fullsize/SLMAP-Antibody-Immunohistochemistry-Paraffin-NBP1-81397-img0017.jpg "Immunohistochemistry-Paraffin: SLMAP Antibody [NBP1-81397] - Staining of human liver, lymph node, smooth muscle and testis using Anti-SLMAP antibody NBP1-81397 (A) shows similar protein distribution across tissues to independent antibody NBP1-81398 (B).")
![Western Blot: SLMAP Antibody [NBP1-81397] - SLMAP transgene protein expression in Tg mice. Western blot of heart lysate from Wt and Tg mice with anti-myc in high (H), moderate (M), and low (L) SLMAP expression, GAPDH was used as loading control. Image collected and cropped by CiteAb from the following publication (//journals.plos.org/plosone/article?id=10.1371/journal.pone.0214669) licensed under a CC-BY license.](http://images.novusbio.com/fullsize/SLMAP-Antibody-Western-Blot-NBP1-81397-img0027.jpg "Western Blot: SLMAP Antibody [NBP1-81397] - SLMAP transgene protein expression in Tg mice. Western blot of heart lysate from Wt and Tg mice with anti-myc in high (H), moderate (M), and low (L) SLMAP expression, GAPDH was used as loading control. Image collected and cropped by CiteAb from the following publication (//journals.plos.org/plosone/article?id=10.1371/journal.pone.0214669) licensed under a CC-BY license.")
![Immunocytochemistry/Immunofluorescence: SLMAP Antibody [NBP1-81397] - Staining of human cell line U-2 OS shows localization to endoplasmic reticulum. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/SLMAP-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-81397-img0009.jpg "Immunocytochemistry/Immunofluorescence: SLMAP Antibody [NBP1-81397] - Staining of human cell line U-2 OS shows localization to endoplasmic reticulum. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: SLMAP Antibody [NBP1-81397] - Staining of human smooth muscle shows high expression.](http://images.novusbio.com/fullsize/SLMAP-Antibody-Immunohistochemistry-Paraffin-NBP1-81397-img0026.jpg "Immunohistochemistry-Paraffin: SLMAP Antibody [NBP1-81397] - Staining of human smooth muscle shows high expression.")
![Western Blot: SLMAP Antibody [NBP1-81397] - Analysis in human cell line CAPAN-2.](http://images.novusbio.com/fullsize/SLMAP-Antibody-Western-Blot-NBP1-81397-img0015.jpg "Western Blot: SLMAP Antibody [NBP1-81397] - Analysis in human cell line CAPAN-2.")
![Western Blot: SLMAP Antibody [NBP1-81397] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://images.novusbio.com/fullsize/SLMAP-Antibody-Western-Blot-NBP1-81397-img0016.jpg "Western Blot: SLMAP Antibody [NBP1-81397] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.")
![Immunohistochemistry-Paraffin: SLMAP Antibody [NBP1-81397] - Staining of human testis.](http://images.novusbio.com/fullsize/SLMAP-Antibody-Immunohistochemistry-Paraffin-NBP1-81397-img0019.jpg "Immunohistochemistry-Paraffin: SLMAP Antibody [NBP1-81397] - Staining of human testis.")
![Immunohistochemistry-Paraffin: SLMAP Antibody [NBP1-81397] - Staining of human lymph node.](http://images.novusbio.com/fullsize/SLMAP-Antibody-Immunohistochemistry-Paraffin-NBP1-81397-img0020.jpg "Immunohistochemistry-Paraffin: SLMAP Antibody [NBP1-81397] - Staining of human lymph node.")
![Immunohistochemistry-Paraffin: SLMAP Antibody [NBP1-81397] - Staining of human liver using Anti-SLMAP antibody NBP1-81397.](http://images.novusbio.com/fullsize/SLMAP-Antibody-Immunohistochemistry-Paraffin-NBP1-81397-img0021.jpg "Immunohistochemistry-Paraffin: SLMAP Antibody [NBP1-81397] - Staining of human liver using Anti-SLMAP antibody NBP1-81397.")
![Immunohistochemistry-Paraffin: SLMAP Antibody [NBP1-81397] - Staining of human smooth muscle using Anti-SLMAP antibody NBP1-81397.](http://images.novusbio.com/fullsize/SLMAP-Antibody-Immunohistochemistry-Paraffin-NBP1-81397-img0022.jpg "Immunohistochemistry-Paraffin: SLMAP Antibody [NBP1-81397] - Staining of human smooth muscle using Anti-SLMAP antibody NBP1-81397.")
![Immunohistochemistry-Paraffin: SLMAP Antibody [NBP1-81397] - Staining of human liver shows low expression as expected.](http://images.novusbio.com/fullsize/SLMAP-Antibody-Immunohistochemistry-Paraffin-NBP1-81397-img0025.jpg "Immunohistochemistry-Paraffin: SLMAP Antibody [NBP1-81397] - Staining of human liver shows low expression as expected.")
![Western Blot: SLMAP Antibody [NBP1-81397] - Postnatal expression of SLMAP3 in Tg mice.(A) Schematic representation of the SLMAP3 transgene construct comprising the forkhead associated domain (FHA), the leucine zipper coiled-coil region (LZ), & the transmembrane domain 2 (TM2) in frame with 6-myc tag, driven by alpha -MHC promoter. (B) Number of SLMAP3 transgene copies in hearts. DNA was isolated from hearts of mice & qRT-PCR was performed with appropriate primers to assess copies of Myc-SLMAP3 transgene. (C) SLMAP3 transgene protein expression in Tg mice. Western blot of heart lysate from Wt & Tg mice with anti-myc in high (H), moderate (M), & low (L) SLMAP3-six myc expression, GAPDH was used as loading control. (D) Endogenous SLMAP isoforms in Wt & Tg myocardium. Western blots of SLMAP isoforms in Wt & Tg mice at 5 weeks of age with anti-SLMAP (~35 kDa, ~43 kDa, ~81 kDa, ~91 kDa, & 110 kDa) & anti-myc antibodies (~110 kDa). SLMAP3 image was acquired with a longer exposure of the same membrane. (E) Quantification & fold change of protein expression levels of SLMAP1 (~35 kDa) & SLMAP2 (~43 kDa) isoforms in Tg mice compared to Wt age-matched littermates at 5 weeks of age; Wt corresponds to 1 (100%), n = 3. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/30934005), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-81397_rabbit-polyclonal-slmap-antibody-310202416121919.jpg "Western Blot: SLMAP Antibody [NBP1-81397] - Postnatal expression of SLMAP3 in Tg mice.(A) Schematic representation of the SLMAP3 transgene construct comprising the forkhead associated domain (FHA), the leucine zipper coiled-coil region (LZ), & the transmembrane domain 2 (TM2) in frame with 6-myc tag, driven by alpha -MHC promoter. (B) Number of SLMAP3 transgene copies in hearts. DNA was isolated from hearts of mice & qRT-PCR was performed with appropriate primers to assess copies of Myc-SLMAP3 transgene. (C) SLMAP3 transgene protein expression in Tg mice. Western blot of heart lysate from Wt & Tg mice with anti-myc in high (H), moderate (M), & low (L) SLMAP3-six myc expression, GAPDH was used as loading control. (D) Endogenous SLMAP isoforms in Wt & Tg myocardium. Western blots of SLMAP isoforms in Wt & Tg mice at 5 weeks of age with anti-SLMAP (~35 kDa, ~43 kDa, ~81 kDa, ~91 kDa, & 110 kDa) & anti-myc antibodies (~110 kDa). SLMAP3 image was acquired with a longer exposure of the same membrane. (E) Quantification & fold change of protein expression levels of SLMAP1 (~35 kDa) & SLMAP2 (~43 kDa) isoforms in Tg mice compared to Wt age-matched littermates at 5 weeks of age; Wt corresponds to 1 (100%), n = 3. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/30934005), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Western Blot: SLMAP Antibody [NBP1-81397] - Expression of calcium handling proteins & their phosphorylation in microsomes.(A) Western blot analysis of SERCA2a protein expression in microsomal fractions & total protein acquired by stain-free. (B) Quantification of SERCA2a in microsomal fractions normalized to total protein assessed by stain free technology in Wt (n = 4) & Tg (n = 7) mice. (C) Western blots for total ryanodine receptor 2 (t-RyR2), it’s phosphorylation on serine 2808 (p-RyR2 ser 2808), calsequestrin (CSQ), total phospholamban (t-PLN) & it’s phosphorylation on serine 16 (p-PLN ser16) in microsomal fractions from 5 weeks old Tg & Wt mice hearts. Anti-calreticulin was used as loading control. Tg SLMAP3 was detected by anti-myc (Myc-SLMAP3). (D) Quantification of RyR2, CSQ, & PLN (monomeric) protein expression in Wt & Tg mice. *p<0.05, #p = 0.053, n (Wt) = 5, n (Tg) = 4. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/30934005), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-81397_rabbit-polyclonal-slmap-antibody-310202416175231.jpg "Western Blot: SLMAP Antibody [NBP1-81397] - Expression of calcium handling proteins & their phosphorylation in microsomes.(A) Western blot analysis of SERCA2a protein expression in microsomal fractions & total protein acquired by stain-free. (B) Quantification of SERCA2a in microsomal fractions normalized to total protein assessed by stain free technology in Wt (n = 4) & Tg (n = 7) mice. (C) Western blots for total ryanodine receptor 2 (t-RyR2), it’s phosphorylation on serine 2808 (p-RyR2 ser 2808), calsequestrin (CSQ), total phospholamban (t-PLN) & it’s phosphorylation on serine 16 (p-PLN ser16) in microsomal fractions from 5 weeks old Tg & Wt mice hearts. Anti-calreticulin was used as loading control. Tg SLMAP3 was detected by anti-myc (Myc-SLMAP3). (D) Quantification of RyR2, CSQ, & PLN (monomeric) protein expression in Wt & Tg mice. *p<0.05, #p = 0.053, n (Wt) = 5, n (Tg) = 4. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/30934005), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Western Blot: SLMAP Antibody [NBP1-81397] - Expression of calcium handling proteins & their phosphorylation in microsomes.(A) Western blot analysis of SERCA2a protein expression in microsomal fractions & total protein acquired by stain-free. (B) Quantification of SERCA2a in microsomal fractions normalized to total protein assessed by stain free technology in Wt (n = 4) & Tg (n = 7) mice. (C) Western blots for total ryanodine receptor 2 (t-RyR2), it’s phosphorylation on serine 2808 (p-RyR2 ser 2808), calsequestrin (CSQ), total phospholamban (t-PLN) & it’s phosphorylation on serine 16 (p-PLN ser16) in microsomal fractions from 5 weeks old Tg & Wt mice hearts. Anti-calreticulin was used as loading control. Tg SLMAP3 was detected by anti-myc (Myc-SLMAP3). (D) Quantification of RyR2, CSQ, & PLN (monomeric) protein expression in Wt & Tg mice. *p<0.05, #p = 0.053, n (Wt) = 5, n (Tg) = 4. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/30934005), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-81397_rabbit-polyclonal-slmap-antibody-310202416163787.jpg "Western Blot: SLMAP Antibody [NBP1-81397] - Expression of calcium handling proteins & their phosphorylation in microsomes.(A) Western blot analysis of SERCA2a protein expression in microsomal fractions & total protein acquired by stain-free. (B) Quantification of SERCA2a in microsomal fractions normalized to total protein assessed by stain free technology in Wt (n = 4) & Tg (n = 7) mice. (C) Western blots for total ryanodine receptor 2 (t-RyR2), it’s phosphorylation on serine 2808 (p-RyR2 ser 2808), calsequestrin (CSQ), total phospholamban (t-PLN) & it’s phosphorylation on serine 16 (p-PLN ser16) in microsomal fractions from 5 weeks old Tg & Wt mice hearts. Anti-calreticulin was used as loading control. Tg SLMAP3 was detected by anti-myc (Myc-SLMAP3). (D) Quantification of RyR2, CSQ, & PLN (monomeric) protein expression in Wt & Tg mice. *p<0.05, #p = 0.053, n (Wt) = 5, n (Tg) = 4. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/30934005), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Western Blot Src [p Tyr419] Antibody [Unconjugated]](https://images.novusbio.com/images2/Src_AF2685_Western_Blot_5209.jpg)
![Simple Western Src [p Tyr419] Antibody [Unconjugated]](https://images.novusbio.com/images2/16327.jpg)
![Immunohistochemistry Src [p Tyr419] Antibody [Unconjugated]](https://images.novusbio.com/images2/Src_AF2685_Immunohistochemistry_7158.jpg)
![Bioactivity IL-2 [Unconjugated]](https://images.novusbio.com/images/202-il_recombinant-human-il-2-protein-bioactivity-174202314946.jpg)
![Simple Western Vav-1 [p Tyr160] Antibody (751411) [Unconjugated]](https://images.novusbio.com/images2/Vav1_MAB37861_Simple_Western_16683.jpg)
![Western Blot Vav-1 [p Tyr160] Antibody (751411) [Unconjugated]](https://images.novusbio.com/images2/Vav-1_MAB37861_Western_Blot_12193.jpg)
![Immunocytochemistry Vav-1 [p Tyr160] Antibody (751411) [Unconjugated]](https://images.novusbio.com/images2/Vav-1_MAB37861_Immunocytochemistry_12236.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")