Home » SLC7A9 » SLC7A9 Proteins » SLC7A9 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

SLC7A9 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for SLC7A9 Protein (NBP1-92409PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

SLC7A9 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SLC7A9.

Source: E. coli

Amino Acid Sequence: YKFGWAQKISKPITMHLQMLMEVVPPEEDPE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SLC7A9
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-92409.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SLC7A9 Recombinant Protein Antigen

  • b(0,+)AT
  • b(0+)AT
  • B(0+)-type amino acid transporter 1
  • BAT1
  • bo+ amino acid transporter
  • CSNU3
  • FLJ94301
  • Glycoprotein-associated amino acid transporter b0+AT1
  • SLC7A9
  • solute carrier family 7 (cationic amino acid transporter, y+ system), member 9
  • Solute carrier family 7 member 9

Background

The SLC7A9 gene encodes a protein that belongs to a family of light subunits of amino acid transporters. This protein plays a role in the high-affinity and sodium-independent transport of cystine and neutral and dibasic amino acids, and appears to function in t

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

SLC3A1 Antibody
NBP2-47272
Immunohistochemistry-Paraffin SLC3A1 Antibody
Immunohistochemistry-Paraffin SLC3A1 Antibody
Western Blot SLC3A1 Antibody
Species: Hu
Applications: IHC, IHC-P, WB
CD98 Antibody
(1C11.7E3) - Azide an ...
NBP2-80662
Western Blot CD98 Antibody (1C11.7E3) - Azide and BSA Free
Flow (Cell Surface) CD98 Antibody (1C11.7E3) - Azide and BSA Free
Immunohistochemistry-Paraffin CD98 Antibody (1C11.7E3) - Azide and BSA Free
Species: Hu
Applications: CyTOF-ready, Flow-CS, Flow, IHC, IHC-P, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(813 Publications)
Species: Hu
Applications: BA
SLC7A5/LAT1
Antibody (BU53) - BSA
NBP2-50465
Immunohistochemistry-Paraffin SLC7A5/LAT1 Antibody (BU53) - BSA Free
Flow (Cell Surface) SLC7A5/LAT1 Antibody (BU53) - BSA Free
Flow (Cell Surface) SLC7A5/LAT1 Antibody (BU53) - BSA Free
(3 Publications)
Species: Hu
Applications: CyTOF-ready, Flow-CS, Flow, IHC, IHC-P
MHC Class I
Antibody (OX18) - BSA
NB120-6405
Flow Cytometry MHC Class I Antibody (OX18) - BSA Free
Immunocytochemistry/ Immunofluorescence MHC Class I Antibody (OX18) - BSA Free
Immunocytochemistry/ Immunofluorescence MHC Class I Antibody (OX18) - BSA Free
(33 Publications)
Species: Rt
Applications: B/N, CyTOF-ready, EM, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NFKBIL1 Antibody
NBP1-70344
Western Blot NFKBIL1 Antibody
Species: Am, Bv, Ca, Pm, Eq, Hu, Pm
Applications: WB
LAT Antibody
NBP2-27104
Western Blot LAT Antibody
Immunohistochemistry-Paraffin LAT Antibody
Species: Hu, Mu, Pm
Applications: IHC, IHC-P, WB
SLC7A8 Antibody
(OTI7D6)
NBP1-47989
Western Blot SLC7A8 Antibody (OTI7D6)
Immunohistochemistry-Paraffin SLC7A8 Antibody (OTI7D6)
Immunohistochemistry-Paraffin SLC7A8 Antibody (OTI7D6)
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB

Lymphotoxin-alpha/TNF- ...
211-TBB/CF
SDS-PAGE Lymphotoxin-alpha/TNF-beta [Unconjugated]
Bioactivity Lymphotoxin-alpha/TNF-beta [Unconjugated]
(8 Publications)
Species: Hu
Applications: BA
UAP56 Antibody
(2F5G7) - BSA Free
NBP2-52455
Western Blot UAP56 Antibody (2F5G7) - BSA Free
Western Blot UAP56 Antibody (2F5G7) - BSA Free
ELISA UAP56 Antibody (2F5G7) - BSA Free
Species: Hu, Mu
Applications: CyTOF-ready, ELISA, ICC/IF, IHC, IHC-P, WB
CAT1 Antibody (2B9)
H00006541-M02
Western Blot CAT1 Antibody (2B9)
Western Blot CAT1 Antibody (2B9)
Western Blot CAT1 Antibody (2B9)
Species: Hu, Mu
Applications: ELISA, S-ELISA, WB
BAT2 Antibody
NBP2-33471
Immunohistochemistry-Paraffin BAT2 Antibody
Immunohistochemistry-Paraffin BAT2 Antibody
Immunohistochemistry-Paraffin BAT2 Antibody
Species: Hu
Applications: IHC, IHC-P
NTAL Antibody
[Unconjugated]
AF4066
Western Blot NTAL Antibody [Unconjugated]
Intracellular Staining by Flow Cytometry NTAL Antibody [Unconjugated]
Species: Hu
Applications: CyTOF-ready, ICFlow, WB
EAAT3 Antibody
(S180-41)
NBP2-59319
Western Blot EAAT3 Antibody (S180-41)
Immunocytochemistry/ Immunofluorescence EAAT3 Antibody (S180-41)
Immunocytochemistry/ Immunofluorescence EAAT3 Antibody (S180-41)
Species: Hu, Rt
Applications: ICC/IF, IP, WB
SLC7A7 Antibody
NBP1-82826
Immunohistochemistry-Paraffin SLC7A7 Antibody
Immunohistochemistry-Paraffin SLC7A7 Antibody
Western Blot SLC7A7 Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
HLA B Antibody
(2G7B10) - BSA Free
NBP2-61871
ELISA HLA B Antibody (2G7B10) - BSA Free
Flow Cytometry HLA B Antibody (2G7B10) - BSA Free
Immunocytochemistry/ Immunofluorescence HLA B Antibody (2G7B10) - BSA Free
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
LST1 Antibody
(LST1/02) - BSA Free
NBP1-45072
Western Blot LST1 Antibody (LST1/02) - BSA Free
Species: Hu
Applications: ICC/IF, IP, WB
xCT Antibody - BSA
Free
NB300-318
Flow Cytometry xCT Antibody - BSA Free
Flow Cytometry xCT Antibody - BSA Free
Flow Cytometry xCT Antibody - BSA Free
(3 Reviews)
(79 Publications)
Species: Hu, Mu, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-P, IP (-), Simple Western, WB
GIT1 Antibody
(S39B-8)
NBP2-22423
Western Blot GIT1 Antibody (S39B-8)
Immunocytochemistry/ Immunofluorescence GIT1 Antibody (S39B-8)
Immunocytochemistry/ Immunofluorescence GIT1 Antibody (S39B-8)
(7 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IP, KO, WB
TEAD1 Antibody -
Azide and BSA Free
NBP2-94035
Chromatin Immunoprecipitation TEAD1 Antibody - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence TEAD1 Antibody - Azide and BSA Free
Western Blot TEAD1 Antibody - Azide and BSA Free
Species: Hu, Mu, Rt
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, WB

Publications for SLC7A9 Protein (NBP1-92409PEP) (0)

There are no publications for SLC7A9 Protein (NBP1-92409PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC7A9 Protein (NBP1-92409PEP) (0)

There are no reviews for SLC7A9 Protein (NBP1-92409PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SLC7A9 Protein (NBP1-92409PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SLC7A9 Products

Research Areas for SLC7A9 Protein (NBP1-92409PEP)

Find related products by research area.

Blogs on SLC7A9.

Check out the latest blog posts on SLC7A9.
The effects of ethanol consumption on glutamate production and xCT
xCT is a sodium independent glutamate transporter that regulates the exchange of extracellular l-cystine and intracellular l-glutamate across the plasma membrane. This process is critical to glutathione production and protection from subsequent ox...  Read full blog post.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005
Flow Cytometry: xCT Antibody [NB300-318] - An intracellular stain was performed on HeLa with xCT Antibody NB300-318 and a matched isotype control. Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature, followed by Rabbit IgG APC-conjugated Secondary Antibody (F0111, R&D Systems).
xCT Antibody - BSA Free
NB300-318

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SLC7A9 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol SLC7A9