![Western Blot: CAT1 Antibody (2B9) [H00006541-M02] - Since miRNA214 is upregulated and miRNA 378 is downregulated following 12 days of TAC, western immunoblotting was carried out for nodal molecule (NF kappa B) and other network molecules (HDGF, BCL2 and SLC7A1). GAPDH was used a loading control, *p<0.05 vs. Sham, (n = 8). Image collected and cropped by CiteAb from the following publication (journals.plos.org/plosone/article?id=10.1371/journal.pone.0170456), licensed under a CC-BY license.](http://images.novusbio.com/fullsize/CAT1-Antibody-2B9-Western-Blot-H00006541-M02-img0003.jpg "Western Blot: CAT1 Antibody (2B9) [H00006541-M02] - Since miRNA214 is upregulated and miRNA 378 is downregulated following 12 days of TAC, western immunoblotting was carried out for nodal molecule (NF kappa B) and other network molecules (HDGF, BCL2 and SLC7A1). GAPDH was used a loading control, *p<0.05 vs. Sham, (n = 8). Image collected and cropped by CiteAb from the following publication (journals.plos.org/plosone/article?id=10.1371/journal.pone.0170456), licensed under a CC-BY license.")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB, ELISA |
| Clone | 2B9 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Description | Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen | SLC7A1 (NP_003036, 431 a.a. ~ 492 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RYQPEQPNLVYQMASTSDELDPADQNELASTNDSQLGFLPEAEMFSLKTILSPKNMEPSKIS |
| Specificity | Reacts with solute carrier family 7 (cationic amino acid transporter, y+ system), member 1. |
| Isotype | IgG1 Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | SLC7A1 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | This antibody is reactive against recombinant protein in WB and ELISA. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | Protein A purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot: CAT1 Antibody (2B9) [H00006541-M02] - Analysis of SLC7A1 expression in transfected 293T cell line by SLC7A1 monoclonal antibody (M02), clone 2B9.Lane 1: SLC7A1 transfected lysate (Predicted MW: 67.6 KDa).Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/CAT1-Antibody-2B9-Western-Blot-H00006541-M02-img0002.jpg "Western Blot: CAT1 Antibody (2B9) [H00006541-M02] - Analysis of SLC7A1 expression in transfected 293T cell line by SLC7A1 monoclonal antibody (M02), clone 2B9.Lane 1: SLC7A1 transfected lysate (Predicted MW: 67.6 KDa).Lane 2: Non-transfected lysate.")
![Sandwich ELISA: CAT1 Antibody (2B9) [H00006541-M02] - Detection limit for recombinant GST tagged SLC7A1 is 0.03 ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/CAT1-Antibody-2B9-Sandwich-ELISA-H00006541-M02-img0001.jpg "Sandwich ELISA: CAT1 Antibody (2B9) [H00006541-M02] - Detection limit for recombinant GST tagged SLC7A1 is 0.03 ng/ml as a capture antibody.")
![Western Blot: CAT1 Antibody (2B9) [H00006541-M02] - A, Since miRNA214 is upregulated & miRNA 378 is downregulated following 12 days of TAC, western immunoblotting was carried out for nodal molecule (NF kappa B) & other network molecules (HDGF, BCL2 & SLC7A1). GAPDH was used a loading control, *p<0.05 vs. Sham, (n = 8). B, HL-1 cardiomyocyte cells were transfected with allstar scrambled control (Vec), or miRNA 214 along with miRNA 378 or miRNA 214 along with antagomir for miRNA 378. The cells were lysed & subjected to immunoblotting for NF kappa B. GAPDH was used as loading control. *p<0.05 vs. Vec (scrambled vector control transfected cells); **p<0.05 vs. miRNA 214 & 378 transfected cells (n = 3). C, HEK 293 cells were transfected with Vec or miRNA 214 along with miRNA 378 or miRNA 214 along with antagomir for miRNA 378. The cell lysates were subjected to immunoblotting for NF kappa B. GAPDH was used as loading control. *p<0.05 vs. Vec; **p<0.05 vs. miRNA 214 & 378 transfected cells (n = 3). Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/28329018), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/h00006541-m02_mouse-monoclonal-cat1-antibody-2b9-310202415482217.jpg "Western Blot: CAT1 Antibody (2B9) [H00006541-M02] - A, Since miRNA214 is upregulated & miRNA 378 is downregulated following 12 days of TAC, western immunoblotting was carried out for nodal molecule (NF kappa B) & other network molecules (HDGF, BCL2 & SLC7A1). GAPDH was used a loading control, *p<0.05 vs. Sham, (n = 8). B, HL-1 cardiomyocyte cells were transfected with allstar scrambled control (Vec), or miRNA 214 along with miRNA 378 or miRNA 214 along with antagomir for miRNA 378. The cells were lysed & subjected to immunoblotting for NF kappa B. GAPDH was used as loading control. *p<0.05 vs. Vec (scrambled vector control transfected cells); **p<0.05 vs. miRNA 214 & 378 transfected cells (n = 3). C, HEK 293 cells were transfected with Vec or miRNA 214 along with miRNA 378 or miRNA 214 along with antagomir for miRNA 378. The cell lysates were subjected to immunoblotting for NF kappa B. GAPDH was used as loading control. *p<0.05 vs. Vec; **p<0.05 vs. miRNA 214 & 378 transfected cells (n = 3). Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/28329018), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
![Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.](https://images.novusbio.com/images/Mouse-IgG1-Kappa-Light-Chain-Isotype-Control-P3-6-2-8-1-Flow-Cytometry-NBP1-43319-img0002.jpg "Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.")