![Western Blot: SLC6A19 Antibody (4F11) [H00340024-M01] - Detection against immunogen (35.53 kDa).](http://images.novusbio.com/fullsize/SLC6A19-Antibody-4F11-Western-Blot-H00340024-M01-img0001.jpg "Western Blot: SLC6A19 Antibody (4F11) [H00340024-M01] - Detection against immunogen (35.53 kDa).")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA |
| Clone | 4F11 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | SLC6A19 (NP_001003841, 326 a.a. ~ 414 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GFRATQRYDDCFSTNILTLINGFDLPEGNVTQENFVDMQQRCNASDPAAYAQLVFQTCDINAFLSEAVEGTGLAFIVFTEAITKMPLSP |
| Specificity | SLC6A19 (4F11) |
| Isotype | IgG2a Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | SLC6A19 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
![Simple Western ACE-2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ACE2_AF933_Simple_Western_18669.jpg)
![Immunohistochemistry ACE-2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ACE-2_AF933_Immunohistochemistry_9800.jpg)
![Immunohistochemistry ACE-2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ACE-2_AF933_Immunohistochemistry_10025.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SLC6A19 |
| Entrez |
|
| OMIM |
|
| Uniprot |
|
![Western Blot Collectrin/TMEM27 Antibody [Unconjugated]](https://images.novusbio.com/images2/Collectrin_AF4965_Western_Blot_5589.jpg)
![Immunohistochemistry Collectrin/TMEM27 Antibody [Unconjugated]](https://images.novusbio.com/images2/Collectrin_AF4965_Immunohistochemistry_11966.jpg)
![Simple Western Collectrin/TMEM27 Antibody [Unconjugated]](https://images.novusbio.com/images2/Collectrin_AF4965_Simple_Western_17518.jpg)
![Immunocytochemistry Aminopeptidase N/CD13 Antibody [Unconjugated]](https://images.novusbio.com/images2/Aminopeptidase_N_AF2335_Immunocytochemistry__Immunofluorescence_17382.jpg)
![Immunohistochemistry Aminopeptidase N/CD13 Antibody [Unconjugated]](https://images.novusbio.com/images2/Aminopeptidase_N_AF2335_Immunohistochemistry_23316.jpg)
