Home » SLC25A25 » SLC25A25 Proteins » SLC25A25 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

SLC25A25 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for SLC25A25 Protein (NBP1-82886PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

SLC25A25 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SLC25A25.

Source: E. coli

Amino Acid Sequence: LRLVFKSLDKKNDGRIDAQEIMQSLRDLGVKISEQQAEKILKSMDKNGTMTIDWNEWRDYHLLHPVENIPEIILYWKHSTIFDVGENLT

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SLC25A25
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-82886.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SLC25A25 Recombinant Protein Antigen

  • APC3
  • calcium-binding mitochondrial carrier protein SCaMC-2
  • KIAA1896RP11-395P17.4
  • MCSC
  • MCSC3
  • MGC105138
  • MGC119514
  • MGC119515
  • MGC119516
  • MGC119517
  • Mitochondrial ATP-Mg/Pi carrier protein 3
  • Mitochondrial Ca(2+)-dependent solute carrier protein 3
  • mitochondrial Ca2+-dependent solute carrier
  • PCSCL
  • SCAMC2
  • SCAMC-2
  • short calcium-binding mitochondrial carrier 2
  • small calcium-binding mitochondrial carrier 2
  • Small calcium-binding mitochondrial carrier protein 2
  • solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 25
  • Solute carrier family 25 member 25
  • solute carrier family 25, member 25

Background

Calcium-dependent mitochondrial solute carrier. Mitochondrial solute carriers shuttle metabolites,nucleotides, and cofactors through the mitochondrial inner membrane. May act as a ATP-Mg/Pi exchanger that mediatesthe transport of Mg-ATP in exchange for phosphate, catalyzing the net uptake or efflux of adenine nucleotides into orfrom the mitochondria

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

APC Antibody - BSA
Free
NB100-91662
Immunocytochemistry/ Immunofluorescence APC Antibody - BSA Free
Flow Cytometry APC Antibody - BSA Free
Immunohistochemistry-Paraffin APC Antibody - BSA Free
(2 Publications)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Coagulation Factor
XIV/Protein C Antibod ...
AF4885
Coagulation Factor XIV/Protein C Antibody
(2 Publications)
Species: Mu
Applications: IP, WB
SLC25A24 Antibody
NBP2-57669
Immunohistochemistry-Paraffin SLC25A24 Antibody
Immunohistochemistry-Paraffin SLC25A24 Antibody
Immunohistochemistry-Paraffin SLC25A24 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Cdc27 Antibody
NBP1-89095
Western Blot Cdc27 Antibody
Immunohistochemistry-Paraffin Cdc27 Antibody
Immunocytochemistry/ Immunofluorescence Cdc27 Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
SLC25A23 Antibody
NBP2-20389
Western Blot SLC25A23 Antibody
Western Blot SLC25A23 Antibody
Immunohistochemistry-Paraffin SLC25A23 Antibody
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Apc2 Antibody
(3A2G2) - BSA Free
NBP2-61656
ELISA Apc2 Antibody (3A2G2) - BSA Free
Flow Cytometry Apc2 Antibody (3A2G2) - BSA Free
Immunohistochemistry Apc2 Antibody (3A2G2) - BSA Free
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
ANAPC2 Antibody
(OTI1A6)
NBP2-01128
Flow Cytometry ANAPC2 Antibody (OTI1A6)
Western Blot ANAPC2 Antibody (OTI1A6)
Immunohistochemistry-Paraffin ANAPC2 Antibody (OTI1A6)
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Apolipoprotein
C-II/ApoC2 Antibody [ ...
AF4497
Western Blot Apolipoprotein C-II/ApoC2 Antibody [Unconjugated]
Simple Western Apolipoprotein C-II/ApoC2 Antibody [Unconjugated]
(1 Publication)
Species: Hu
Applications: Simple Western, WB
SLC25A12 Antibody
NBP1-89020
Western Blot SLC25A12 Antibody
Western Blot SLC25A12 Antibody
Immunohistochemistry-Paraffin SLC25A12 Antibody
(1 Review)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Cdc20 Antibody
NB100-59828
Immunoprecipitation Cdc20 Antibody
Western Blot Cdc20 Antibody
Immunohistochemistry-Paraffin Cdc20 Antibody
(6 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Cyclin B1 Antibody
[Unconjugated]
AF6000
Immunohistochemistry Cyclin B1 Antibody [Unconjugated]
Western Blot Cyclin B1 Antibody [Unconjugated]
Simple Western Cyclin B1 Antibody [Unconjugated]
(12 Publications)
Species: Hu, Mu
Applications: IHC, Simple Western, WB
ZNF645 Antibody
NBP2-21037
Western Blot ZNF645 Antibody
Immunohistochemistry-Paraffin ZNF645 Antibody
Species: Hu
Applications: IHC, IHC-P, WB
FZR1/CDH1 Antibody
NBP2-15840
Western Blot FZR1/CDH1 Antibody
Immunocytochemistry/ Immunofluorescence FZR1/CDH1 Antibody
Immunohistochemistry-Paraffin FZR1/CDH1 Antibody
(5 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Cdc23 Antibody -
BSA Free
NBP1-77156
Immunocytochemistry/ Immunofluorescence Cdc23 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Cdc23 Antibody - BSA Free
Western Blot Cdc23 Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Apc7 Antibody -
BSA Free
NBP1-77379
Immunocytochemistry/ Immunofluorescence Apc7 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Apc7 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Apc7 Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
MUL1 Antibody
(5H6.2D5) - BSA Free
NBP2-31361
Western Blot MUL1 Antibody (5H6.2D5) - BSA Free
Immunohistochemistry-Paraffin MUL1 Antibody (5H6.2D5) - BSA Free
Immunohistochemistry-Paraffin MUL1 Antibody (5H6.2D5) - BSA Free
Species: Hu
Applications: IHC, IHC-P, WB
TRIM50 Antibody
NBP1-81988
Immunohistochemistry-Paraffin TRIM50 Antibody
Species: Hu
Applications: IHC, IHC-P
CDC16 Antibody -
BSA Free
NBP1-77155
Immunocytochemistry/ Immunofluorescence CDC16 Antibody - BSA Free
Immunohistochemistry CDC16 Antibody - BSA Free
Immunohistochemistry CDC16 Antibody - BSA Free
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
E-Cadherin
Antibody [Unconjugate
AF748
Immunocytochemistry E-Cadherin Antibody [Unconjugated]
Immunohistochemistry E-Cadherin Antibody [Unconjugated]
Immunocytochemistry E-Cadherin Antibody [Unconjugated]
(142 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, ICC, IHC, Simple Western, WB
SLC25A25
Recombinant Protein A
NBP1-82886PEP
SLC25A25 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for SLC25A25 Protein (NBP1-82886PEP) (0)

There are no publications for SLC25A25 Protein (NBP1-82886PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC25A25 Protein (NBP1-82886PEP) (0)

There are no reviews for SLC25A25 Protein (NBP1-82886PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SLC25A25 Protein (NBP1-82886PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SLC25A25 Products

Blogs on SLC25A25

There are no specific blogs for SLC25A25, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SLC25A25 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol SLC25A25