![Western Blot: SLC19A3 Antibody [NBP1-69703] - Expression of adipose-specific genes and adipose-enhanced genes. Semi-quantitative RT-PCR and/or Western blot analysis (WB) of CSN1S1, SLC19A3, and LVRN (AQPEP) in selected tissues: subcutaneous adipose tissue (Ad), brain (Br), heart (He), kidney (Ki), lung (Lu), liver (Li), and skeletal muscle (Mu). Target sizes for RT-PCR: 213 bp (CSN1S1), 170 bp (SLC19A3) and 193 bp (LVRN (AQPEP)). Expected sizes for full-length proteins were 21.7 kDa and 55.7 kDa for CSN1S1 and SLC19A3, respectively. Cyclophilin (CYC) (325 bp) and GAPDH (38 kDa) were used as a reference gene and protein, respectively. Image collected and cropped by CiteAb from the following publication (//www.nature.com/articles/s41598-019-39582-8) licensed under a CC-BY license.](http://images.novusbio.com/fullsize/SLC19A3-Antibody-Western-Blot-NBP1-69703-img0006.jpg "Western Blot: SLC19A3 Antibody [NBP1-69703] - Expression of adipose-specific genes and adipose-enhanced genes. Semi-quantitative RT-PCR and/or Western blot analysis (WB) of CSN1S1, SLC19A3, and LVRN (AQPEP) in selected tissues: subcutaneous adipose tissue (Ad), brain (Br), heart (He), kidney (Ki), lung (Lu), liver (Li), and skeletal muscle (Mu). Target sizes for RT-PCR: 213 bp (CSN1S1), 170 bp (SLC19A3) and 193 bp (LVRN (AQPEP)). Expected sizes for full-length proteins were 21.7 kDa and 55.7 kDa for CSN1S1 and SLC19A3, respectively. Cyclophilin (CYC) (325 bp) and GAPDH (38 kDa) were used as a reference gene and protein, respectively. Image collected and cropped by CiteAb from the following publication (//www.nature.com/articles/s41598-019-39582-8) licensed under a CC-BY license.")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Concentration | 0.5 mg/ml |
| Description | The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
| Immunogen | Synthetic peptides corresponding to SLC19A3(solute carrier family 19, member 3) The peptide sequence was selected from the middle region of SLC19A3 (NP_079519). Peptide sequence FATAGFNQVLNYVQILWDYKAPSQDSSIYNGAVEAIATFGGAVAAFAVGY. The peptide sequence for this immunogen was taken from within the described region. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SLC19A3 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Theoretical MW | 56 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
|
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
![Western Blot RFC1 Antibody [Unconjugated]](https://images.novusbio.com/images2/RFC1_AF6457_Western_Blot_9874.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot: SLC19A3 Antibody [NBP1-69703] - This Anti-SLC19A3 antibody was used in Western Blot of DU145 tissue lysate at a concentration of 1ug/ml.](http://images.novusbio.com/fullsize/SLC19A3-Antibody-Western-Blot-NBP1-69703-img0001.jpg "Western Blot: SLC19A3 Antibody [NBP1-69703] - This Anti-SLC19A3 antibody was used in Western Blot of DU145 tissue lysate at a concentration of 1ug/ml.")
![Western Blot: SLC19A3 Antibody [NBP1-69703] - Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.](http://images.novusbio.com/fullsize/SLC19A3-Antibody-Western-Blot-NBP1-69703-img0002.jpg "Western Blot: SLC19A3 Antibody [NBP1-69703] - Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.")
![Western Blot: SLC19A3 Antibody [NBP1-69703] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.](http://images.novusbio.com/fullsize/SLC19A3-Antibody-Western-Blot-NBP1-69703-img0003.jpg "Western Blot: SLC19A3 Antibody [NBP1-69703] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.")
![Western Blot: SLC19A3 Antibody [NBP1-69703] - Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.](http://images.novusbio.com/fullsize/SLC19A3-Antibody-Western-Blot-NBP1-69703-img0004.jpg "Western Blot: SLC19A3 Antibody [NBP1-69703] - Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.")
![Western Blot: SLC19A3 Antibody [NBP1-69703] - Sample Tissue: Human Ovary Tumor Antibody Dilution: 1.0 ug/ml](http://images.novusbio.com/fullsize/SLC19A3-Antibody-Western-Blot-NBP1-69703-img0005.jpg "Western Blot: SLC19A3 Antibody [NBP1-69703] - Sample Tissue: Human Ovary Tumor Antibody Dilution: 1.0 ug/ml")
![CCL21/6Ckine [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "CCL21/6Ckine [Unconjugated]")
![N/A PSG1 [HRP]](https://images.novusbio.com/images2/DATA_PSG1_DPSG10_ELISA_797.jpg)
![N/A PSG1 [HRP]](https://images.novusbio.com/images2/PSG-1_DPSG10_ELISA_164.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")