Home » SIT1 » SIT1 Proteins » SIT1 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

SIT1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for SIT1 Protein (NBP2-13311PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

SIT1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SIT1.

Source: E. coli

Amino Acid Sequence: GRSGESVEEVPLYGNLHYLQTGRLSQDPEPDQQDPTLGGPARAAEEVMCYTSLQLRPPQGRIPGPGTPVKYSEVVLDSEPKSQASGPEPELYASVCAQTR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SIT1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-13311.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SIT1 Recombinant Protein Antigen

  • gp30/40
  • MGC125908
  • MGC125909
  • RP11-331F9.5
  • SHP2 interacting transmembrane adaptor
  • SHP2-interacting transmembrane adapter protein
  • SHP2-interacting transmembrane adaptor protein
  • signaling threshold regulating transmembrane adaptor 1
  • signaling threshold-regulating transmembrane adapter 1
  • SIT1
  • SITMGC125910
  • suppression inducing transmembrane adaptor 1
  • Suppression-inducing transmembrane adapter 1

Background

Negatively regulates TCR (T-cell antigen receptor)-mediated signaling in T-cells. Involved in positive selection of T-cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

IL-13 [Biotin]
DY413
N/A IL-13 [Biotin]
(148 Publications)
Species: Mu
Applications: ELISA
IL-10 [Biotin]
DY417
N/A IL-10 [Biotin]
(301 Publications)
Species: Mu
Applications: ELISA
IL-4 [Unconjugated]
6507-IL/CF
Bioactivity IL-4 [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
IL-5 [HRP]
M5000
N/A IL-5 [HRP]
N/A IL-5 [HRP]
(92 Publications)
Species: Mu
Applications: ELISA
CD4 Antibody - BSA
Free
NBP1-19371
Immunohistochemistry-Frozen CD4 Antibody - BSA Free
Immunohistochemistry-Paraffin CD4 Antibody - BSA Free
Flow Cytometry CD4 Antibody - BSA Free
(9 Reviews)
(50 Publications)
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
IL-2 [Unconjugated]
202-IL
Bioactivity IL-2 [Unconjugated]
(4 Reviews)
(377 Publications)
Species: Hu
Applications: BA
IFN-gamma
[Unconjugated]
285-IF
Bioactivity IFN-gamma [Unconjugated]
SDS-PAGE IFN-gamma [Unconjugated]
SEC-MALS IFN-gamma [Unconjugated]
(2 Reviews)
(452 Publications)
Species: Hu
Applications: BA
ATAT1 Antibody
NBP2-48990
Immunocytochemistry/ Immunofluorescence ATAT1 Antibody
Immunohistochemistry-Paraffin ATAT1 Antibody
Immunohistochemistry-Paraffin ATAT1 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
TAT Antibody
NBP1-79286
Western Blot TAT Antibody
(1 Review)
Species: Rt
Applications: WB
RNASE3 Antibody
NBP2-33778
Western Blot RNASE3 Antibody
Immunohistochemistry-Paraffin RNASE3 Antibody
Immunohistochemistry-Paraffin RNASE3 Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
CTLA-4
[Unconjugated]
7268-CT
Bioactivity CTLA-4 [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
SHP-2/PTPN11 [p
Tyr542] Antibody [Unc ...
AF3790
Western Blot SHP-2/PTPN11 [p Tyr542] Antibody [Unconjugated]
Simple Western SHP-2/PTPN11 [p Tyr542] Antibody [Unconjugated]
Immunocytochemistry SHP-2/PTPN11 [p Tyr542] Antibody [Unconjugated]
(2 Publications)
Species: Hu, Mu
Applications: ICC, Simple Western, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(811 Publications)
Species: Hu
Applications: BA
GLYAT Antibody
NBP2-58917
Western Blot GLYAT Antibody
Immunohistochemistry-Paraffin GLYAT Antibody
Immunohistochemistry-Paraffin GLYAT Antibody
Species: Hu
Applications: IHC, IHC-P, WB
CD25/IL-2R alpha
[HRP]
DR2A00
N/A CD25/IL-2R alpha [HRP]
N/A CD25/IL-2R alpha [HRP]
(36 Publications)
Species: Hu
Applications: ELISA
PAG1 Antibody
(504004) [Unconjugate
MAB5285
Simple Western PAG1 Antibody (504004) [Unconjugated]
Western Blot PAG1 Antibody (504004) [Unconjugated]
(1 Publication)
Species: Hu
Applications: Simple Western, WB
ISG20 Antibody
(1B2-3C9)
H00003669-M01
Western Blot ISG20 Antibody (1B2-3C9)
Western Blot ISG20 Antibody (1B2-3C9)
Immunocytochemistry/ Immunofluorescence ISG20 Antibody (1B2-3C9)
(1 Review)
(2 Publications)
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
LAT Antibody
NBP2-27104
Western Blot LAT Antibody
Immunohistochemistry-Paraffin LAT Antibody
Species: Hu, Mu, Pm
Applications: IHC, IHC-P, WB
Recombinant Human
SLC6A20 GST (N-Term) ...
H00054716-Q01
Other Recombinant Human SLC6A20 GST (N-Term) Protein
Species: Hu
Applications: ELISA, AP, PA, WB
TRIM Antibody
[Unconjugated]
AF4708
Western Blot TRIM Antibody [Unconjugated]
Intracellular Staining by Flow Cytometry TRIM Antibody [Unconjugated]
Simple Western TRIM Antibody [Unconjugated]
Species: Hu
Applications: CyTOF-ready, ICFlow, Simple Western, WB

Publications for SIT1 Protein (NBP2-13311PEP) (0)

There are no publications for SIT1 Protein (NBP2-13311PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SIT1 Protein (NBP2-13311PEP) (0)

There are no reviews for SIT1 Protein (NBP2-13311PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SIT1 Protein (NBP2-13311PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SIT1 Products

Research Areas for SIT1 Protein (NBP2-13311PEP)

Find related products by research area.

Blogs on SIT1

There are no specific blogs for SIT1, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SIT1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol SIT1