![Western Blot: SGTA Antibody (2E11) [H00006449-M06] - SGTA expression in PC-12 ( Cat # L012V1 ).](http://images.novusbio.com/fullsize/SGTA-Antibody-2E11-Western-Blot-H00006449-M06-img0002.jpg "Western Blot: SGTA Antibody (2E11) [H00006449-M06] - SGTA expression in PC-12 ( Cat # L012V1 ).")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, ICC/IF, IP |
| Clone | 2E11 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Description | Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen | SGTA (NP_003012.1, 42 a.a. ~ 123 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AFGVTVEDSDLALPQTLPEIFEAAATGKEMPQDLRSPARTPPSEEDSAEAERLKTEGNEQMKVENFEAAVHFYGKAIELNPA |
| Specificity | SGTA (2E11) |
| Isotype | IgG2b Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | SGTA |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF and ELISA. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for SGTA Antibody (H00006449-M06)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: SGTA Antibody (2E11.) [H00006449-M06] - SGTA Antibody (2E11) [H00006449-M06] - Analysis of monoclonal antibody to SGTA on HeLa cell. Antibody concentration 10 ug/ml](http://images.novusbio.com/fullsize/SGTA-Antibody-2E11-Immunocytochemistry-Immunofluorescence-H00006449-M06-img0008.jpg "Immunocytochemistry/Immunofluorescence: SGTA Antibody (2E11.) [H00006449-M06] - SGTA Antibody (2E11) [H00006449-M06] - Analysis of monoclonal antibody to SGTA on HeLa cell. Antibody concentration 10 ug/ml")
![Western Blot: SGTA Antibody (2E11) [H00006449-M06] - SGTA expression in HeLa ( Cat # L013V1 ).](http://images.novusbio.com/fullsize/SGTA-Antibody-2E11-Western-Blot-H00006449-M06-img0003.jpg "Western Blot: SGTA Antibody (2E11) [H00006449-M06] - SGTA expression in HeLa ( Cat # L013V1 ).")
![Immunocytochemistry/Immunofluorescence: SGTA Antibody (2E11) [H00006449-M06] - Analysis of monoclonal antibody to SGTA on HeLa cell. Antibody concentration 10 ug/ml](http://images.novusbio.com/fullsize/SGTA-Antibody-2E11-Immunocytochemistry-Immunofluorescence-H00006449-M06-img0004.jpg "Immunocytochemistry/Immunofluorescence: SGTA Antibody (2E11) [H00006449-M06] - Analysis of monoclonal antibody to SGTA on HeLa cell. Antibody concentration 10 ug/ml")
![Sandwich ELISA: SGTA Antibody (2E11) [H00006449-M06] - Detection limit for recombinant GST tagged SGTA is 0.03 ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/SGTA-Antibody-2E11-Sandwich-ELISA-H00006449-M06-img0007.jpg "Sandwich ELISA: SGTA Antibody (2E11) [H00006449-M06] - Detection limit for recombinant GST tagged SGTA is 0.03 ng/ml as a capture antibody.")
![Immunoprecipitation: SGTA Antibody (2E11) [H00006449-M06] - Analysis of SGTA transfected lysate using anti-SGTA monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with SGTA rabbit polyclonal antibody.](http://images.novusbio.com/fullsize/SGTA-Antibody-2E11-Immunoprecipitation-H00006449-M06-img0006.jpg "Immunoprecipitation: SGTA Antibody (2E11) [H00006449-M06] - Analysis of SGTA transfected lysate using anti-SGTA monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with SGTA rabbit polyclonal antibody.")
