Home » SFPQ » SFPQ Antibodies » SFPQ Antibody
Novus Biologicals products are now on bio-techne.com

SFPQ Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: SFPQ Antibody [NBP2-49147] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2,. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Genetic Strategies: Western Blot: SFPQ Antibody [NBP2-49147] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2,. Remaining relative intensity is presented. Loading ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: SFPQ Antibody [NBP2-49147] - Staining of human endometrium, kidney, lymphoid tissues and testis using Anti-SFPQ antibody NBP2-49147 (A) shows similar protein ...read more
Immunocytochemistry/ Immunofluorescence: SFPQ Antibody [NBP2-49147] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: SFPQ Antibody [NBP2-49147] - Staining of humanlymph node shows strong nuclear positivity in lymphoid cells.
Immunohistochemistry-Paraffin: SFPQ Antibody [NBP2-49147] - Staining of human endometrium shows strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: SFPQ Antibody [NBP2-49147] - Staining of human kidney shows strong nuclear positivity in cells in tubules.
Immunohistochemistry-Paraffin: SFPQ Antibody [NBP2-49147] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

    

Genetic Strategies

    

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

SFPQ Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: EEEMMIRQREMEEQMRRQREESYSRMGYMDPRERDMRMGGGGAMNMGDPYGSGGQKFPPLGGGGGI
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SFPQ
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Knockdown Validated
  • Western Blot 0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SFPQ Recombinant Protein Antigen (NBP2-49147PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SFPQ Antibody

  • 100 kDa DNA-pairing protein
  • DNA-binding p52/p100 complex, 100 kDa subunit
  • hPOMp100
  • polypyrimidine tract binding protein associated
  • polypyrimidine tract-binding protein-associated splicing factor
  • Polypyrimidine tract-binding protein-associated-splicing factor
  • PSFPOMP100
  • PTB-associated splicing factor
  • PTB-associated-splicing factor
  • splicing factor proline/glutamine rich (polypyrimidine tract binding proteinassociated)
  • splicing factor proline/glutamine rich (polypyrimidine tract-bindingprotein-associated)
  • splicing factor proline/glutamine-rich
  • splicing factor, proline- and glutamine-rich

Background

PSF/SFPQ is a multifunctional protein know to participate in a variety of nuclear processes and may function to link transcription and pre-mRNA processing. PSF/SFPQ bears an RNA recognition motif (RRM) further indicating its role in post-transcriptional processes. PSF has been shown to associate with p54nrb/NonO to modulate androgen receptor-mediated transcription. Additionally, it has recently been show to associate with XRN2 and p54nrb/NonO to facilitate pre-mRNA 3' processing and transcription termination. Alternate names for PSF/SFPQ include polypyrimidine tract-binding protein-associated-splicing factor, PTB-associated-splicing factor, splicing factor proline-and glutamine-rich, and POMP100.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NONO Antibody
NB100-1556
Western Blot NONO Antibody
Immunohistochemistry-Paraffin NONO Antibody
Immunocytochemistry/ Immunofluorescence NONO Antibody
(2 Reviews)
(5 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
FKBP51/FKBP5
Antibody [Unconjugate
AF4094
Western Blot FKBP51/FKBP5 Antibody [Unconjugated]
Simple Western FKBP51/FKBP5 Antibody [Unconjugated]
Immunohistochemistry FKBP51/FKBP5 Antibody [Unconjugated]
(9 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
Ets-1 Antibody
[Unconjugated]
AF7284
Western Blot Ets-1 Antibody [Unconjugated]
Immunohistochemistry Ets-1 Antibody [Unconjugated]
Species: Hu, Mu, Rt
Applications: IHC, WB
IFIT2 Antibody
NBP1-31164
Western Blot IFIT2 Antibody
Western Blot IFIT2 Antibody
Western Blot IFIT2 Antibody
(2 Reviews)
(5 Publications)
Species: Hu
Applications: ICC/IF, WB
DDX6 Antibody
NB200-191
Immunoprecipitation DDX6 Antibody
Immunohistochemistry-Paraffin DDX6 Antibody
Immunocytochemistry/ Immunofluorescence DDX6 Antibody
(1 Review)
(44 Publications)
Species: Ha, Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Splicing factor,
arginine/serine-rich ...
NBP1-87381
Immunohistochemistry-Paraffin Splicing factor, arginine/serine-rich 11 Antibody
Immunohistochemistry-Paraffin Splicing factor, arginine/serine-rich 11 Antibody
Immunohistochemistry-Paraffin Splicing factor, arginine/serine-rich 11 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
PSPC1 Antibody
NBP1-83801
Immunohistochemistry-Paraffin PSPC1 Antibody
Immunohistochemistry-Paraffin PSPC1 Antibody
Immunohistochemistry-Paraffin PSPC1 Antibody
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Androgen R/NR3C4
[p Ser213, p Ser210] ...
NB100-56603
Western Blot Androgen R/NR3C4 [p Ser213, p Ser210] Antibody (156C135.2) - BSA Free
(14 Publications)
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
LIGHT/TNFSF14
[Unconjugated]
664-LI
SDS-PAGE LIGHT/TNFSF14 [Unconjugated]
Bioactivity LIGHT/TNFSF14 [Unconjugated]
(21 Publications)
Species: Hu
Applications: BA
FUS Antibody
NB100-565
Immunohistochemistry-Paraffin FUS Antibody
Immunohistochemistry-Paraffin FUS Antibody
Western Blot FUS Antibody
(4 Reviews)
(31 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KO, WB
IL-3 [Unconjugated]
203-IL
SDS-PAGE IL-3 [Unconjugated]
Bioactivity IL-3 [Unconjugated]
SEC-MALS IL-3 [Unconjugated]
(213 Publications)
Species: Hu
Applications: BA
IGF-I/IGF-1
[Unconjugated]
291-G1
SDS-PAGE IGF-I/IGF-1 [Unconjugated]
Bioactivity IGF-I/IGF-1 [Unconjugated]
Mass Spectrometry IGF-I/IGF-1 [Unconjugated]
(221 Publications)
Species: Hu
Applications: BA
SF2 Antibody
NBP2-20324
Western Blot SF2 Antibody
Western Blot SF2 Antibody
Immunohistochemistry-Paraffin SF2 Antibody
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
IGFBP-rp1/IGFBP-7
Antibody [Unconjugate ...
AF1334
Western Blot IGFBP-rp1/IGFBP-7 Antibody [Unconjugated]
Immunohistochemistry IGFBP-rp1/IGFBP-7 Antibody [Unconjugated]
(13 Publications)
Species: Hu
Applications: IHC, WB
S5a/Angiocidin
Antibody
NBP2-19952
Knockdown Validated S5a/Angiocidin Antibody
Western Blot S5a/Angiocidin Antibody
Western Blot S5a/Angiocidin Antibody
(2 Publications)
Species: Hu
Applications: ICC/IF, KD, WB
ARSF Antibody -
BSA Free
NBP3-04502
Immunocytochemistry/ Immunofluorescence ARSF Antibody - BSA Free
Species: Hu
Applications: ICC/IF, WB
PTBP1 Antibody
(3H8)
H00005725-M01
Western Blot PTBP1 Antibody (3H8)
Western Blot PTBP1 Antibody (3H8)
Western Blot PTBP1 Antibody (3H8)
(4 Publications)
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, Single-Cell Western, WB
HDAC1 Antibody
NB100-56340
Knockout Validated HDAC1 Antibody
Simple Western HDAC1 Antibody
Western Blot HDAC1 Antibody
(2 Reviews)
(19 Publications)
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
PTBP2 Antibody
NBP2-19997
Western Blot PTBP2 Antibody
Immunohistochemistry-Paraffin PTBP2 Antibody
Western Blot PTBP2 Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Progesterone
R/NR3C3 Antibody [Unc ...
AF5415
Immunocytochemistry Progesterone R/NR3C3 Antibody [Unconjugated]
Immunohistochemistry Progesterone R/NR3C3 Antibody [Unconjugated]
Western Blot Progesterone R/NR3C3 Antibody [Unconjugated]
(2 Publications)
Species: Hu
Applications: ICC, IHC, Simple Western, WB

Publications for SFPQ Antibody (NBP2-49147) (0)

There are no publications for SFPQ Antibody (NBP2-49147).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SFPQ Antibody (NBP2-49147) (0)

There are no reviews for SFPQ Antibody (NBP2-49147). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SFPQ Antibody (NBP2-49147) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SFPQ Products

Research Areas for SFPQ Antibody (NBP2-49147)

Find related products by research area.

Blogs on SFPQ

There are no specific blogs for SFPQ, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SFPQ Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol SFPQ