![Western Blot: Seryl tRNA synthetase Antibody (1H4) [H00006301-M01] - SARS monoclonal antibody (M01), clone 1H4 Analysis of SARS expression in Jurkat.](http://images.novusbio.com/fullsize/Seryl-tRNA-synthetase-Antibody-1H4-Western-Blot-H00006301-M01-img0013.jpg "Western Blot: Seryl tRNA synthetase Antibody (1H4) [H00006301-M01] - SARS monoclonal antibody (M01), clone 1H4 Analysis of SARS expression in Jurkat.")
| Reactivity | Hu, Mu, ZeSpecies Glossary |
| Applications | WB, ELISA, ICC/IF, IHC, IP, ChIP, KD |
| Clone | 1H4 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Description | Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen | SARS (AAH00716, 1 a.a. ~ 514 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MVLDLDLFRVDKGGDPALIRETQEKRFKDPGLVDQLVKADSEWRRCRFRADNLNKLKNLCSKTIGEKMKKKEPVGDDESVPENVLSFDDLTADALANLKVSQIKKVRLLIDEAILKCDAERIKLEAERFENLREIGNLLHPSVPISNDEDVDNKVERIWGDCTVRKKYSHVDLVVMVDGFEGEKGAVVAGSRGYFLKGVLVFLEQALIQYALRTLGSRGYIPIYTPFFMRKEVMQEVAQLSQFDEELYKVIGKGSEKSDDNSYDEKYLIATSEQPIAALHRDEWLRPEDLPIKYAGLSTCFRQEVGSHGRDTRGIFRVHQFEKIEQFVYSSPHDNKSWEMFEEMITTAEEFYQSLGIPYHIVNIVSGSLNHAASKKLDLEAWFPGSGAFRELVSCSNCTDYQARRLRIRYGQTKKMMDKVEFVHMLNATMCATTRTICAILENYQTEKGITVPEKLKEFMPPGLQELIPFVKPAPIEQEPSKKQKKQHEGSKKKAAARDVTLENRLQNMEVTDA |
| Specificity | SARS - seryl-tRNA synthetase |
| Isotype | IgG2a Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | SARS |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Antibody reactivity against recominant protein and cell lysate for WB. It has been used for IF, IHC-P, RNAi Validation and ELISA. |
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
![Simple Western Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Simple_Western_21888.jpg)
![Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunocytochemistry__Immunofluorescence_17777.jpg)
![Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunohistochemistry_23317.jpg)
![Myoglobin Antibody [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Myoglobin Antibody [Unconjugated]")
Secondary Antibodies |
Isotype Controls |
Research Areas for Seryl tRNA synthetase Antibody (H00006301-M01)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: Seryl tRNA synthetase Antibody (1H4) [H00006301-M01] - Analysis of monoclonal antibody to SARS on HeLa cell. Antibody concentration 25 ug/ml.](http://images.novusbio.com/fullsize/Seryl-tRNA-synthetase-Antibody-1H4-Immunocytochemistry-Immunofluorescence-H00006301-M01-img0008.jpg "Immunocytochemistry/Immunofluorescence: Seryl tRNA synthetase Antibody (1H4) [H00006301-M01] - Analysis of monoclonal antibody to SARS on HeLa cell. Antibody concentration 25 ug/ml.")
![Immunohistochemistry-Paraffin: Seryl tRNA synthetase Antibody (1H4) [H00006301-M01] - Analysis of monoclonal antibody to SARS on formalin-fixed paraffin-embedded human colon tissue. Antibody concentration 3 ug/ml.](http://images.novusbio.com/fullsize/Seryl-tRNA-synthetase-Antibody-1H4-Immunohistochemistry-Paraffin-H00006301-M01-img0010.jpg "Immunohistochemistry-Paraffin: Seryl tRNA synthetase Antibody (1H4) [H00006301-M01] - Analysis of monoclonal antibody to SARS on formalin-fixed paraffin-embedded human colon tissue. Antibody concentration 3 ug/ml.")
![Western Blot: Seryl tRNA synthetase Antibody (1H4) [H00006301-M01] - Analysis of SARS over-expressed 293 cell line, cotransfected with SARS Validated Chimera RNAi ( Cat # H00006301-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with SARS monoclonal antibody (M01), clone 1H4 (Cat # H00006301-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.](http://images.novusbio.com/fullsize/Seryl-tRNA-synthetase-Antibody-1H4-Western-Blot-H00006301-M01-img0011.jpg "Western Blot: Seryl tRNA synthetase Antibody (1H4) [H00006301-M01] - Analysis of SARS over-expressed 293 cell line, cotransfected with SARS Validated Chimera RNAi ( Cat # H00006301-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with SARS monoclonal antibody (M01), clone 1H4 (Cat # H00006301-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.")
![Western Blot: Seryl tRNA synthetase Antibody (1H4) [H00006301-M01] - Analysis of SARS expression in transfected 293T cell line by SARS monoclonal antibody (M01), clone 1H4.Lane 1: SARS transfected lysate(58.8 KDa).Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/Seryl-tRNA-synthetase-Antibody-1H4-Western-Blot-H00006301-M01-img0014.jpg "Western Blot: Seryl tRNA synthetase Antibody (1H4) [H00006301-M01] - Analysis of SARS expression in transfected 293T cell line by SARS monoclonal antibody (M01), clone 1H4.Lane 1: SARS transfected lysate(58.8 KDa).Lane 2: Non-transfected lysate.")
![ELISA: Seryl tRNA synthetase Antibody (1H4) [H00006301-M01] - Detection limit for recombinant GST tagged SARS is approximately 0.03ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/Seryl-tRNA-synthetase-Antibody-1H4-ELISA-H00006301-M01-img0015.jpg "ELISA: Seryl tRNA synthetase Antibody (1H4) [H00006301-M01] - Detection limit for recombinant GST tagged SARS is approximately 0.03ng/ml as a capture antibody.")
![SDS-PAGE LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_719.jpg)
![Bioactivity LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_721.jpg)
![N/A Kallikrein 3/PSA [HRP]](https://images.novusbio.com/images2/DATA_Kallikrein_3_DKK300_ELISA_729.jpg)
![N/A Kallikrein 3/PSA [HRP]](https://images.novusbio.com/images2/DATA_Kallikrein_3_DKK300_ELISA_730.jpg)
![N/A Kallikrein 3/PSA [HRP]](https://images.novusbio.com/images2/Kallikrein_3_DKK300_ELISA_124.jpg)
