Home » Serpin C1/Antithrombin-III » Serpin C1/Antithrombin-III Proteins » Serpin C1/Antithrombin-III Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Serpin C1/Antithrombin-III Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Serpin C1/Antithrombin-III Protein (NBP1-90077PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Serpin C1/Antithrombin-III Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SERPINC1.

Source: E. coli

Amino Acid Sequence: PSEAINELTVLVLVNTIYFKGLWKSKFSPENTRKELFYKADGESCSASMMYQEGKFRYRRVAEGTQVLELPFKGDDITMVLILPKPEKSLAKVEKELTPEVLQEWLDELEEMMLVVHMPRFRIEDGFSLKEQLQDMGLV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SERPINC1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-90077.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.
Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Serpin C1/Antithrombin-III Recombinant Protein Antigen

  • Antithrombin-III
  • AT3antithrombin-III
  • ATIII
  • ATIIIantithrombin III
  • MGC22579
  • serine (or cysteine) proteinase inhibitor, clade C (antithrombin), member 1
  • serine-cysteine proteinase inhibitor clade C member 1
  • Serpin C1
  • serpin peptidase inhibitor, clade C (antithrombin), member 1

Background

Antithrombin III (ATH III) is a plasma protein synthesised in the liver. Normal plasma levels are 115 to 160mg/L. ATH III consists of a single polypeptide chain and has a molecular weight of 58kDa. ATH III is a serine protease inhibitor and regulates coagulation by the formation of covalently liked complexes. ATH III also has a heparin binding site and in the presence of heparin the inhibition of thrombin, factors IXa, Xa and XIa is enhanced 1000 fold. Low levels of ATH III (functional or concentration) are associated with deep vein thrombosis and pulmonary embolism. Antithrombin assays are based on immunologic, enzymatic, or clotting properties

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Coagulation Factor
II/Thrombin Antibody
NBP1-58268
Immunohistochemistry-Paraffin Coagulation Factor II/Thrombin Antibody
Immunohistochemistry-Paraffin Coagulation Factor II/Thrombin Antibody
Western Blot Coagulation Factor II/Thrombin Antibody
(1 Review)
(3 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Recombinant Human
PRH2 GST (N-Term) Pro ...
H00005555-P01
SDS-PAGE Recombinant Human PRH2 GST (N-Term) Protein
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Plasminogen
Antibody
NB600-930
Western Blot Plasminogen Antibody
Western Blot Plasminogen Antibody
Western Blot Plasminogen Antibody
(2 Reviews)
(6 Publications)
Species: Hu, Rt
Applications: ELISA, WB
ATAT1 Antibody
NBP2-48990
Immunocytochemistry/ Immunofluorescence ATAT1 Antibody
Immunohistochemistry-Paraffin ATAT1 Antibody
Immunohistochemistry-Paraffin ATAT1 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
TAT Antibody
NBP1-79286
Western Blot TAT Antibody
(1 Review)
Species: Rt
Applications: WB
Coagulation Factor
X Antibody
NBP1-33320
Western Blot Coagulation Factor X Antibody
Immunocytochemistry/ Immunofluorescence Coagulation Factor X Antibody
Immunohistochemistry-Paraffin Coagulation Factor X Antibody
(2 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Serpin E1/PAI-1
Antibody - BSA Free
NBP1-19773
Western Blot Serpin E1/PAI-1 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Serpin E1/PAI-1 Antibody - BSA Free
Immunohistochemistry-Paraffin Serpin E1/PAI-1 Antibody - BSA Free
(2 Reviews)
(32 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
t-Plasminogen
Activator/tPA [HRP]
DTPA00
N/A t-Plasminogen Activator/tPA [HRP]
N/A t-Plasminogen Activator/tPA [HRP]
(7 Publications)
Species: Hu
Applications: ELISA
Factor VIII
Antibody - BSA Free
NB100-91761
Western Blot Factor VIII Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Factor VIII Antibody - BSA Free
Western Blot Factor VIII Antibody - BSA Free
(5 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Albumin Antibody
(188835) [Unconjugate ...
MAB1455
Simple Western Albumin Antibody (188835) [Unconjugated] - Serum
Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum
Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum
(3 Reviews)
(54 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Von Willebrand
Factor Antibody
NB600-586
Dual RNAscope ISH-IHC Von Willebrand Factor Antibody
Immunohistochemistry-Frozen Von Willebrand Factor Antibody
Immunohistochemistry Von Willebrand Factor Antibody
(3 Reviews)
(14 Publications)
Species: Ca, Fe, Hu, Mu
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr, IHC-P
Serpin F2/alpha
2-Antiplasmin Antibod
AF1239
Immunohistochemistry Serpin F2/alpha 2-Antiplasmin Antibody
(4 Publications)
Species: Mu
Applications: IHC, IP, WB
Coagulation Factor
III/Tissue Factor [HR ...
DCF300
N/A Coagulation Factor III/Tissue Factor [HRP]
N/A Coagulation Factor III/Tissue Factor [HRP]
(25 Publications)
Species: Hu
Applications: ELISA
CXCL4/PF4 [Biotin]
DY795
N/A CXCL4/PF4 [Biotin]
(24 Publications)
Species: Hu
Applications: ELISA
Factor V Antibody
(HL2421) - Azide and ...
NBP3-25459
Western Blot Factor V Antibody (HL2421) - Azide and BSA Free
Western Blot Factor V Antibody (HL2421) - Azide and BSA Free
Species: Hu, Rt
Applications: WB

Thrombomodulin/BDCA-3 ...
AF3894
Immunocytochemistry Thrombomodulin/BDCA-3 Antibody [Unconjugated]
Immunohistochemistry Thrombomodulin/BDCA-3 Antibody [Unconjugated]
(14 Publications)
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, IP, WB

Publications for Serpin C1/Antithrombin-III Protein (NBP1-90077PEP) (0)

There are no publications for Serpin C1/Antithrombin-III Protein (NBP1-90077PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Serpin C1/Antithrombin-III Protein (NBP1-90077PEP) (0)

There are no reviews for Serpin C1/Antithrombin-III Protein (NBP1-90077PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Serpin C1/Antithrombin-III Protein (NBP1-90077PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Serpin C1/Antithrombin-III Products

Research Areas for Serpin C1/Antithrombin-III Protein (NBP1-90077PEP)

Find related products by research area.

Blogs on Serpin C1/Antithrombin-III

There are no specific blogs for Serpin C1/Antithrombin-III, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Serpin C1/Antithrombin-III Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol SERPINC1