Novus Biologicals products are now on bio-techne.com

Septin-4 Recombinant Protein Antigen

Name: Septin-4 Recombinant Protein Antigen
Brand: Novus Biologicals
SKU: NBP1-90093PEP
Price: 279 USD

Images

There are currently no images for Septin-4 Protein (NBP1-90093PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	AC

Order Details

100% Guarantee on every product

Septin-4 Recombinant Protein Antigen Summary

Description	A recombinant protein antigen with a N-terminal His6-ABP tag corresponding Septin - 4. Source: E. coli Amino Acid Sequence: TMLVRTHMQDLKDVTRETHYENYRAQCIQSMTRLVVKERNRNKLTRESGTDFPIPAVPPGTDPETEKLIREKDEELRRMQE Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source	E. coli
Protein/Peptide Type	Recombinant Protein Antigen
Gene	SEPTIN4
Purity	>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions	Antibody Competition 10 - 100 molar excess
Application Notes	This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-90093. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com For further blocking peptide related information and a protocol, click here.
Theoretical MW	27 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -20C. Avoid freeze-thaw cycles.
Buffer	PBS and 1M Urea, pH 7.4.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Septin-4 Recombinant Protein Antigen

Apoptosis-related protein in the TGF-beta signaling pathway
ARTSPeanut-like protein 2
Bradeion beta
BRADEION
Brain protein H5
CE5B3
Cell division control-related protein 2
Cerebral protein 7
H5
hCDCREL-2SEP4
hucep-7
MART
peanut-like 2 (Drosophila)
peanut-like 2
PNUTL2CE5B3 beta
septin 4
septin-4
septin-M

Background

Apoptosis is related to many diseases and development. Mitochondrial proteins, such as cytochrome c, Apaf-1, and AIF play important role in apoptosis. A novel mitochondrial septin-like protein was identified recently and designated ARTS for apoptosis related protein in TGF-b signaling pathway. ARTS that is encoded by the human septin H5/PNUTL2/CDCrel2b gene is located to mitochondria and translocates to the nucleus when apoptosis occurs. ARTS is expressed in many tissues. It enhances cell death induced by TGF-b and, to a lesser extent, by other apoptotic agents, such as TNF-a and Fas ligand.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

HIST1H4F
Overexpression Lysate

NBP2-07996

Species: Hu

Applications: WB

H4/n Antibody
(3E7H2) - BSA Free

NBP2-52486

Western Blot H4/n Antibody (3E7H2) - BSA Free

Flow Cytometry H4/n Antibody (3E7H2) - BSA Free

Species: Hu

Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB

Histamine H4R
Antibody - BSA Free

NLS3775

(2 Publications)

Species: Hu, Pm

Applications: ICC/IF, IHC, IHC-P

CCDC6 Antibody

NBP1-85351

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

RhoB Antibody

NBP2-20154

Species: Hu, Mu, Rt

Applications: IHC, IHC-P, WB

HMX1 Antibody

H00003166-B01P-50ug

Species: Hu

Applications: WB

SUR1 Antibody
(S289-16)

NBP2-59320

Immunocytochemistry/ Immunofluorescence SUR1 Antibody (S289-16)

(2 Reviews)

(4 Publications)

Species: Ha, Hu, Mu, Rt

Applications: ICC/IF, IHC, WB

AKAP4 Antibody

NBP1-89165

(1 Publication)

Species: Hu

Applications: IHC, IHC-P

Histone H1
Antibody (HH1/957)

NBP2-45184

Immunohistochemistry-Paraffin Histone H1 Antibody (HH1/957)

(1 Review)

Species: Hu, Mu, Rt

Applications: Flow, ICC/IF, IHC, IHC-P, WB

XIAP Antibody
[Unconjugated]

AF8221

Simple Western XIAP Antibody [Unconjugated]

Knockout Validated XIAP Antibody [Unconjugated]

(23 Publications)

Species: Hu, Mu, Rt

Applications: IHC, KO, Simple Western, WB

H2A Antibody (4C10)

H00008337-M01

Species: Hu

Applications: ELISA, ICC/IF, WB

RhoC Antibody (1B7)

H00000389-M06

Immunocytochemistry/ Immunofluorescence RhoC Antibody (1B7)

(1 Publication)

Species: Hu, Mu, Rt

Applications: ELISA, ICC/IF, IHC, S-ELISA, WB

Histone H2a
Antibody

NB100-56346

Immunohistochemistry-Paraffin Histone H2a Antibody

(1 Review)

(4 Publications)

Species: Hu, Mu, Sh

Applications: ELISA, Flow, IHC, IHC-P, WB

GPR50 Antibody

H00009248-B01P

(1 Publication)

Species: Hu, Mu, Rt

Applications: Flow, KO, WB

Haptoglobin [HRP]

DHAPG0

(7 Publications)

Species: Hu

Applications: ELISA

Septin-4
Recombinant Protein A

NBP1-90093PEP

Species: Hu

Applications: AC

Publications for Septin-4 Protein (NBP1-90093PEP) (0)

There are no publications for Septin-4 Protein (NBP1-90093PEP).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Septin-4 Protein (NBP1-90093PEP) (0)

There are no reviews for Septin-4 Protein (NBP1-90093PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Septin-4 Protein (NBP1-90093PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Septin-4 Products

Research Areas for Septin-4 Protein (NBP1-90093PEP)

Find related products by research area.

Apoptosis

Blogs on Septin-4

There are no specific blogs for Septin-4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Histone H2a Antibody
NB100-56346

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

Mass

Concentration

Volume

Molecular Weight* g/mol

Review this Product

Be the first to review our Septin-4 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol

SEPTIN4

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

Septin-4 Recombinant Protein Antigen

Species Glossary

Images

Product Details

Order Details

Septin-4 Recombinant Protein Antigen Summary

Applications/Dilutions

Packaging, Storage & Formulations

Alternate Names for Septin-4 Recombinant Protein Antigen

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for Septin-4 Protein (NBP1-90093PEP) (0)

Reviews for Septin-4 Protein (NBP1-90093PEP) (0)

FAQs for Septin-4 Protein (NBP1-90093PEP) (0)

Additional Septin-4 Products

Research Areas for Septin-4 Protein (NBP1-90093PEP)

Blogs on Septin-4

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Molarity Calculator

Review this Product

Bioinformatics