![Western Blot: SDHD Antibody [NBP2-83506] - Host: Rabbit. Target Name: SDHD. Sample Tissue: Mouse SP2/0 Whole Cell lysates. Antibody Dilution: 1ug/ml](http://images.novusbio.com/fullsize/SDHD-Antibody-Western-Blot-NBP2-83506-img0001.jpg "Western Blot: SDHD Antibody [NBP2-83506] - Host: Rabbit. Target Name: SDHD. Sample Tissue: Mouse SP2/0 Whole Cell lysates. Antibody Dilution: 1ug/ml")
| Reactivity | MuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Concentration | 0.5 mg/ml |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse SDHD. Peptide sequence: HSGSKAASLHWTSERVVSVLLLGLIPAGYLNPCSVVDYSLAAALTLHSHW The peptide sequence for this immunogen was taken from within the described region. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SDHD |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
![Simple Western CD117/c-kit Antibody [Unconjugated]](https://images.novusbio.com/images2/CD117_AF1356_Simple_Western_17480.jpg)
![Western Blot CD117/c-kit Antibody [Unconjugated]](https://images.novusbio.com/images2/CD117_AF1356_Western_Blot_18637.jpg)
![Immunohistochemistry CD117/c-kit Antibody [Unconjugated]](https://images.novusbio.com/images2/SCF_R_AF1356_Immunohistochemistry_9746.jpg)
| Publication using NBP2-83506 | Applications | Species |
|---|---|---|
| Yamashita N, Withers H, Morimoto Y et al. MUC1-C integrates aerobic glycolysis with suppression of oxidative phosphorylation in triple-negative breast cancer stem cells iScience 2023-11-17 [PMID: 37915591] (WB, Human) | WB | Human |
Secondary Antibodies |
Isotype Controls |
Research Areas for SDHD Antibody (NBP2-83506)Find related products by research area.
|
|
HIF Antibodies: Beyond HIF-1 alpha The hypoxia inducible factors are a family of heterodimeric transcription factors which are activated in response to lowered oxygen levels, or hypoxia. Although it may seem that HIF-1 alpha receives all the attention, other HIF antibodies, such as the... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SDHD |
![Immunohistochemistry Ret Antibody [Unconjugated]](https://images.novusbio.com/images2/Ret_AF482_Immunohistochemistry_10194.jpg)
![Western Blot Ret Antibody [Unconjugated]](https://images.novusbio.com/images/af482_mouse-ret-affinity-purified-polyclonal-ab-8220249503265.jpg)
![Immunohistochemistry Ret Antibody [Unconjugated]](https://images.novusbio.com/images/af482_mouse-ret-affinity-purified-polyclonal-ab-8220249505961.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")