Home » SCN3A » SCN3A Proteins » Recombinant Human SCN3A GST (N-Term) Protein
Novus Biologicals products are now on bio-techne.com

Recombinant Human SCN3A GST (N-Term) Protein

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
12.5% SDS-PAGE Stained with Coomassie Blue.
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Product Discontinued
View other related SCN3A Peptides and Proteins

Order Details


    • Catalog Number
      H00006328-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human SCN3A GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1861-1960 of Human SCN3A

Source: Wheat Germ (in vitro)

Amino Acid Sequence: LCESGEMDALRIQMEDRFMASNPSKVSYEPITTTLKRKQEEVSAAIIQRNFRCYLLKQRLKNISSNYNKEAIKGRIDLPIKQDMIIDKLNGNSTPEKTDG
Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
SCN3A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using H00006328-Q01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SCN3A GST (N-Term) Protein

  • brain III voltage-gated sodium channel
  • KIAA1356
  • NAC3
  • Nav1.3
  • SCN3A
  • Sodium channel protein brain III subunit alpha
  • sodium channel protein type 3 subunit alpha
  • Sodium channel protein type III subunit alpha
  • sodium channel, voltage-gated, type III, alpha polypeptide
  • sodium channel, voltage-gated, type III, alpha subunit
  • Voltage-gated sodium channel subtype III
  • Voltage-gated sodium channel subunit alpha Nav1.3

Background

SCN3A - sodium channel, voltage-gated, type III, alpha

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Recombinant Human
SCN2A GST (N-Term) Pr ...
H00006326-Q01
Other Recombinant Human SCN2A GST (N-Term) Protein
Species: Hu
Applications: ELISA, AP, PA, WB
Nav1.7 Antibody
(N68/6)
NBP2-12904
Immunocytochemistry/ Immunofluorescence Nav1.7 Antibody (N68/6)
Western Blot Nav1.7 Antibody (N68/6)
Immunohistochemistry Nav1.7 Antibody (N68/6)
(1 Publication)
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, MiAr, WB
Nav1.8 Antibody
(S134)
NBP1-47615
Immunohistochemistry Nav1.8 Antibody (S134)
Immunocytochemistry/ Immunofluorescence Nav1.8 Antibody (S134)
Immunocytochemistry/ Immunofluorescence Nav1.8 Antibody (S134)
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, MiAr, WB
Nav1.6 Antibody
NBP2-84177
Immunohistochemistry-Paraffin Nav1.6 Antibody
Immunohistochemistry-Paraffin Nav1.6 Antibody
Western Blot Nav1.6 Antibody
Species: Hu
Applications: IHC, IHC-P, WB
Nav1.5 Antibody
(4G8:1G7)
NB110-61010
Nav1.5 Antibody (4G8:1G7)
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IP, RIA, WB
SCN11A Antibody
NBP1-82600
Immunohistochemistry-Paraffin SCN11A Antibody
Species: Hu
Applications: IHC, IHC-P
RPL5 Antibody
NBP1-31413
Immunocytochemistry/ Immunofluorescence RPL5 Antibody
Knockdown Validated RPL5 Antibody
Immunohistochemistry-Paraffin RPL5 Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
SCN3B Antibody
(S396-29)
NBP2-59318
Immunocytochemistry/ Immunofluorescence SCN3B Antibody (S396-29)
Western Blot SCN3B Antibody (S396-29)
Immunocytochemistry/ Immunofluorescence SCN3B Antibody (S396-29)
(1 Review)
Species: Hu, Mu, Rt
Applications: ICC/IF, Simple Western, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(808 Publications)
Species: Hu
Applications: BA
ATF3 Antibody
NBP1-85816
Immunohistochemistry-Paraffin ATF3 Antibody
Immunohistochemistry-Paraffin ATF3 Antibody
Immunohistochemistry-Paraffin ATF3 Antibody
(3 Reviews)
(30 Publications)
Species: Fe, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, KO, WB
CDT2 Antibody
NB100-40840
Immunoprecipitation CDT2 Antibody
Western Blot CDT2 Antibody
Immunohistochemistry-Paraffin CDT2 Antibody
(1 Review)
(7 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
ZNF198 Antibody
NBP1-84685
Immunohistochemistry-Paraffin ZNF198 Antibody
Immunohistochemistry-Paraffin ZNF198 Antibody
Immunohistochemistry-Paraffin ZNF198 Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
PAMR1 Antibody
AF6517
Western Blot PAMR1 Antibody
Species: Hu
Applications: WB
TfR (Transferrin
R) Antibody - BSA Fre
NB100-92243
Immunohistochemistry-Paraffin TfR (Transferrin R) Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence TfR (Transferrin R) Antibody - BSA Free
Western Blot TfR (Transferrin R) Antibody - BSA Free
(1 Review)
(18 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, PLA, WB
SCN1B Antibody -
BSA Free
NBP2-94559
Western Blot SCN1B Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: WB
Trypsin 3/PRSS3
Antibody [Unconjugate
AF3565
Immunohistochemistry Trypsin 3/PRSS3 Antibody [Unconjugated]
Immunohistochemistry Trypsin 3/PRSS3 Antibody [Unconjugated]
(2 Publications)
Species: Mu
Applications: IHC, IP, WB

Publications for SCN3A Partial Recombinant Protein (H00006328-Q01)(1)


Reviews for SCN3A Partial Recombinant Protein (H00006328-Q01) (0)

There are no reviews for SCN3A Partial Recombinant Protein (H00006328-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SCN3A Partial Recombinant Protein (H00006328-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SCN3A Products

Array H00006328-Q01

Research Areas for SCN3A Partial Recombinant Protein (H00006328-Q01)

Find related products by research area.

Blogs on SCN3A

There are no specific blogs for SCN3A, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SCN3A GST (N-Term) Protein and receive a gift card or discount.


Bioinformatics

Gene Symbol SCN3A