![Immunohistochemistry-Paraffin: SAH3 Antibody [NBP2-47293] - Analysis in human stomach and liver tissues. Corresponding AHCYL2 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/SAH3-Antibody-Immunohistochemistry-Paraffin-NBP2-47293-img0005.jpg "Immunohistochemistry-Paraffin: SAH3 Antibody [NBP2-47293] - Analysis in human stomach and liver tissues. Corresponding AHCYL2 RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: GKVPQASAMKRSDPHHQHQRHRDGGEALVSPDGTVTEAPRTVKKQIQFADQKQEFNKRPTKI |
| Predicted Species | Rat (98%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | AHCYL2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP2-47293 | Applications | Species |
|---|---|---|
| Li JG, Barrero C, Gupta S et al. Homocysteine modulates 5-lipoxygenase expression level via DNA methylation. Aging Cell. 2016-11-29 [PMID: 27896923] (WB, Mouse) | WB | Mouse |
Secondary Antibodies |
Isotype Controls |
Research Areas for SAH3 Antibody (NBP2-47293)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | AHCYL2 |
![Western Blot: SAH3 Antibody [NBP2-47293] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG.](http://images.novusbio.com/fullsize/SAH3-Antibody-Western-Blot-NBP2-47293-img0003.jpg "Western Blot: SAH3 Antibody [NBP2-47293] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG.")
![Immunocytochemistry/Immunofluorescence: SAH3 Antibody [NBP2-47293] - Immunofluorescent staining of human cell line PC-3 shows localization to nucleoplasm & cytosol.](http://images.novusbio.com/fullsize/SAH3-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-47293-img0004.jpg "Immunocytochemistry/Immunofluorescence: SAH3 Antibody [NBP2-47293] - Immunofluorescent staining of human cell line PC-3 shows localization to nucleoplasm & cytosol.")
![Immunohistochemistry-Paraffin: SAH3 Antibody [NBP2-47293] - Staining of human stomach shows moderate to strong membranous positivity in parietal cells.](http://images.novusbio.com/fullsize/SAH3-Antibody-Immunohistochemistry-Paraffin-NBP2-47293-img0008.jpg "Immunohistochemistry-Paraffin: SAH3 Antibody [NBP2-47293] - Staining of human stomach shows moderate to strong membranous positivity in parietal cells.")
![Immunohistochemistry-Paraffin: SAH3 Antibody [NBP2-47293] - Staining of human small intestine shows weak cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/SAH3-Antibody-Immunohistochemistry-Paraffin-NBP2-47293-img0006.jpg "Immunohistochemistry-Paraffin: SAH3 Antibody [NBP2-47293] - Staining of human small intestine shows weak cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: SAH3 Antibody [NBP2-47293] - Staining of human cerebral cortex shows weak to moderate cytoplasmic positivity in neurons.](http://images.novusbio.com/fullsize/SAH3-Antibody-Immunohistochemistry-Paraffin-NBP2-47293-img0007.jpg "Immunohistochemistry-Paraffin: SAH3 Antibody [NBP2-47293] - Staining of human cerebral cortex shows weak to moderate cytoplasmic positivity in neurons.")
![Immunohistochemistry-Paraffin: SAH3 Antibody [NBP2-47293] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/SAH3-Antibody-Immunohistochemistry-Paraffin-NBP2-47293-img0009.jpg "Immunohistochemistry-Paraffin: SAH3 Antibody [NBP2-47293] - Staining of human liver shows no positivity in hepatocytes as expected.")
![Bioactivity IL-4 [Unconjugated]](https://images.novusbio.com/images/protein/6507-ilcf_recombinant-human-il-4-cho-expressed-protein-cf-bioactivity-272020133214.jpg)
![Bioactivity GM-CSF [Unconjugated]](https://images.novusbio.com/images/protein/7954-gmcf_recombinant-human-gm-csf-cho-expressed-protein-cf-bioactivity-272020121514.jpg)
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")