Home » RSK4 » RSK4 Proteins » RSK4 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

RSK4 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for RSK4 Protein (NBP1-87108PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

RSK4 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RPS6KA6.

Source: E. coli

Amino Acid Sequence: PFKPASGKPDDTFCFDPEFTAKTPKDSPGLPASANAHQLFKGFSFVATSIAEEYKITPITSANVLPIVQINGNAAQFGEVYELKEDIGVGSYSVCKRCIHATTNMEFAVKIIDKSK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
RPS6KA6
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87108.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.
Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for RSK4 Recombinant Protein Antigen

  • EC 2.7.11
  • EC 2.7.11.1
  • p90-RSK 6
  • p90RSK6
  • pp90RSK4
  • PP90RSK4,90 kDa ribosomal protein S6 kinase 6
  • ribosomal protein S6 kinase alpha-6
  • ribosomal protein S6 kinase, 90kDa, polypeptide 6
  • Ribosomal S6 kinase 4
  • RPS6KA6
  • RSK4
  • RSK-4
  • RSK4ribosomal protein S6 kinase, 90kD, polypeptide 6
  • S6K-alpha 6
  • S6K-alpha-6

Background

RSK4 is a member of the family of 90-kDa ribosomal S6 kinases (1). These proteins are a class of serine/threonine kinases that are activated in response to various extracellular signals, including growth factors, polypeptide hormones and neurotransmitters (2). RSK4 is most abundantly expressed in brain and kidney. The predicted protein of 746 amino acids shows a high level of homology to three previously isolated members of the human RSK family. RSK2 is involved in Coffin-Lowry syndrome and nonspecific MRX. The localization of RSK4 in the interval that is commonly deleted in mentally retarded males together with the high degree of amino acid identity with RSK2 suggests that RSK4 plays a role in normal neuronal development (3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Ribosomal Protein
S6/RPS6 Antibody
NB100-1595
Immunohistochemistry-Paraffin Ribosomal Protein S6/RPS6 Antibody
Western Blot Ribosomal Protein S6/RPS6 Antibody
Immunoprecipitation Ribosomal Protein S6/RPS6 Antibody
(1 Review)
(6 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Tbp7 Antibody
NBP1-87799
Immunohistochemistry-Paraffin Tbp7 Antibody
Western Blot Tbp7 Antibody
Western Blot Tbp7 Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
RSK2 Antibody
NBP2-20237
Western Blot RSK2 Antibody
Western Blot RSK2 Antibody
Western Blot RSK2 Antibody
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
RSK1 [p Ser380]
Antibody (1024A) [Unc ...
MAB79671
Immunocytochemistry RSK1 [p Ser380] Antibody (1024A) [Unconjugated]
Simple Western RSK1 [p Ser380] Antibody (1024A) [Unconjugated]
Western Blot RSK1 [p Ser380] Antibody (1024A) [Unconjugated]
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC, Simple Western, WB
KCNN4 Antibody
NBP2-33694
Immunohistochemistry-Paraffin KCNN4 Antibody
Immunohistochemistry-Paraffin KCNN4 Antibody
Immunohistochemistry-Paraffin KCNN4 Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
RSK3 Antibody
(3C4C8) - BSA Free
NBP2-52555
Western Blot RSK3 Antibody (3C4C8) - BSA Free
ELISA RSK3 Antibody (3C4C8) - BSA Free
Western Blot RSK3 Antibody (3C4C8) - BSA Free
(1 Publication)
Species: Hu, Mu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
ERK2 Antibody
[Unconjugated]
AF1230
Western Blot ERK2 Antibody [Unconjugated]
Immunohistochemistry ERK2 Antibody [Unconjugated]
Knockout Validated ERK2 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
p21/CIP1/CDKN1A
Antibody (WA-1)
NBP2-29463
Immunohistochemistry-Paraffin p21/CIP1/CDKN1A Antibody (WA-1)
(24 Publications)
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
EphB2 Antibody
[Unconjugated]
AF467
Simple Western EphB2 Antibody [Unconjugated]
Western Blot EphB2 Antibody [Unconjugated]
Immunocytochemistry EphB2 Antibody [Unconjugated]
(5 Reviews)
(62 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Calnexin Antibody
- BSA Free
NB100-1965
Western Blot Calnexin Antibody - BSA Free
Immunohistochemistry Calnexin Antibody - BSA Free
Immunohistochemistry Calnexin Antibody - BSA Free
(3 Reviews)
(45 Publications)
Species: Av, Bv, Ch, Dr, Gp, Hu, Mu, Po, Rb, Rt, Sh, Xp, Ze
Applications: Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
CCDC8 Antibody
NBP1-85085
Immunocytochemistry/ Immunofluorescence CCDC8 Antibody
Immunohistochemistry-Paraffin CCDC8 Antibody
(1 Review)
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
TfR (Transferrin
R) Antibody - BSA Fre
NB100-92243
Immunohistochemistry-Paraffin TfR (Transferrin R) Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence TfR (Transferrin R) Antibody - BSA Free
Western Blot TfR (Transferrin R) Antibody - BSA Free
(1 Review)
(18 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, PLA, WB
BRN4 Antibody
NBP2-68787
Immunocytochemistry/ Immunofluorescence BRN4 Antibody
Western Blot BRN4 Antibody
Species: Hu
Applications: ICC/IF, WB
CHM Antibody
NBP1-84954
Immunohistochemistry-Paraffin CHM Antibody
Immunohistochemistry-Paraffin CHM Antibody
Immunohistochemistry-Paraffin CHM Antibody
Species: Hu
Applications: IHC, IHC-P
Pyruvate
Dehydrogenase Kinase ...
NB100-2383
Immunocytochemistry/ Immunofluorescence Pyruvate Dehydrogenase Kinase 1/PDK1 Antibody
Western Blot Pyruvate Dehydrogenase Kinase 1/PDK1 Antibody
Western Blot Pyruvate Dehydrogenase Kinase 1/PDK1 Antibody
(2 Reviews)
(6 Publications)
Species: Hu
Applications: ICC/IF, WB
PDK-1 Antibody
(650308) [Unconjugate
MAB864
Immunocytochemistry PDK-1 Antibody (650308) [Unconjugated]
Western Blot PDK-1 Antibody (650308) [Unconjugated]
Simple Western PDK-1 Antibody (650308) [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: ICC, Simple Western, WB
TCEAL1 Antibody
(OTI2G10)
NBP2-46085
Immunohistochemistry TCEAL1 Antibody (OTI2G10)
Immunohistochemistry TCEAL1 Antibody (OTI2G10)
Immunohistochemistry TCEAL1 Antibody (OTI2G10)
Species: Hu
Applications: IHC, WB
RSK4 Recombinant
Protein Antigen
NBP1-87108PEP
RSK4 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for RSK4 Protein (NBP1-87108PEP) (0)

There are no publications for RSK4 Protein (NBP1-87108PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RSK4 Protein (NBP1-87108PEP) (0)

There are no reviews for RSK4 Protein (NBP1-87108PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for RSK4 Protein (NBP1-87108PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RSK4 Products

Research Areas for RSK4 Protein (NBP1-87108PEP)

Find related products by research area.

Blogs on RSK4

There are no specific blogs for RSK4, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Simple Western lane view shows lysates of COLO 205 human colorectal adenocarcinoma cell line and MBA‑MB‑468 human breast cancer cell line, loaded at 0.2 mg/mL. A specific band was detected for EphB2 at approximately 139 and 146 kDa (as indicated) using 20 µg/mL of Goat Anti-Human/Mouse EphB2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF467) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
EphB2 Antibody [Unconjugated]
AF467
Western Blot: Calnexin Antibody [NB100-1965] - Subcellular localization of TM6SF2.Immunoaffinity isolation of ER and Golgi complex from mouse liver. ER and Golgi fractions were prepared from mouse liver microsomes by immunoaffinity chromatography as described under Experimental Procedures. Microsome membranes were dissolved in RIPA buffer, and equal volumes were separated on 10% SDS-PAGE and immunoblotting as described under Experimental Procedures. BiP, binding immunoglobulin protein; Gos28, Golgi SNAP receptor complex member 1; *, nonspecific band. Image collected and cropped by Citeab from the following publication (Inactivation of Tm6sf2, a Gene Defective in Fatty Liver Disease, Impairs Lipidation but Not Secretion of Very Low Density Lipoproteins. J Biol Chem (2016) licensed under a CC-BY license.
Calnexin Antibody - BSA Free
NB100-1965

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our RSK4 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol RPS6KA6