![Western Blot: RPL28 Antibody [NBP2-93881] - Analysis of extracts of various cell lines, using RPL28 at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit . Exposure time: 60s.](http://images.novusbio.com/fullsize/RPL28-Antibody-Western-Blot-NBP2-93881-img0002.jpg "Western Blot: RPL28 Antibody [NBP2-93881] - Analysis of extracts of various cell lines, using RPL28 at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit . Exposure time: 60s.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human RPL28 (NP_000982.2). MSAHLQWMVVRNCSSFLIKRNKQTYSTEPNNLKARNSFRYNGLIHRKTVGVEPAADGKGVVVVIKRRSGQRKPATSYVRTTINKNARATLSSIRHMIRKN |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | RPL28 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Reviewed Applications |
|
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol |
| Preservative | 0.01% Thimerosal |
| Purity | Affinity purified |
| Images | Ratings | Applications | Species | Date | Details | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
reviewed by:
Verified Customer |
Simple Western | Human | 04/06/2023 |
Summary
Comments
|
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
5 | |
4 | |
3 | |
2 | |
1 |
| Verified Customer 04/06/2023 |
||
| Application: | Simple Western | |
| Species: | Human |
| Gene Symbol | RPL28 |
![Immunocytochemistry/Immunofluorescence: RPL28 Antibody [NBP2-93881] - Analysis of L929 cells using RPL28 at dilution of 1:100. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/RPL28-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-93881-img0001.jpg "Immunocytochemistry/Immunofluorescence: RPL28 Antibody [NBP2-93881] - Analysis of L929 cells using RPL28 at dilution of 1:100. Blue: DAPI for nuclear staining.")
![Immunocytochemistry TM4SF1/L6 Antibody (877621) [Unconjugated]](https://images.novusbio.com/images2/TM4SF1_MAB8164_Immunohistochemistry_19084.jpg)
![Flow Cytometry TM4SF1/L6 Antibody (877621) [Unconjugated]](https://images.novusbio.com/images2/TM4SF1_MAB8164_Flow_Cytometry_14781.jpg)
![Flow Cytometry TM4SF1/L6 Antibody (877621) [Unconjugated]](https://images.novusbio.com/images2/TM4SF1_MAB8164_Flow_Cytometry_14884.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
