Reactivity | Hu, Mu, RtSpecies Glossary |
Applications | WB, ICC/IF |
Clonality | Polyclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Format | Azide and BSA Free |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human RPL28 (NP_000982.2). MSAHLQWMVVRNCSSFLIKRNKQTYSTEPNNLKARNSFRYNGLIHRKTVGVEPAADGKGVVVVIKRRSGQRKPATSYVRTTINKNARATLSSIRHMIRKN |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | RPL28 |
Purity | Affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
|
Reviewed Applications |
|
Storage | Store at -20C. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.3), 50% glycerol |
Preservative | 0.01% Thimerosal |
Purity | Affinity purified |
Images | Ratings | Applications | Species | Date | Details | ||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
reviewed by:
Verified Customer |
Simple Western | Human | 04/06/2023 |
Summary
Comments
|
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
5 | |
4 | |
3 | |
2 | |
1 |
Verified Customer 04/06/2023 |
||
Application: | Simple Western | |
Species: | Human |
Gene Symbol | RPL28 |