![Western Blot: RPL28 Antibody [NBP2-13254] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented.](http://images.novusbio.com/fullsize/RPL28-Antibody-Western-Blot-NBP2-13254-img0006.jpg "Western Blot: RPL28 Antibody [NBP2-13254] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC, KD |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the amino acids: QRKPATSYVRTTINKNARATLSSIRHMIRKNKYRPDLRMAAIRRASAILRSQKPVMVKRKRT |
| Predicted Species | Mouse (98%), Rat (98%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | RPL28 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation/Permeabilization: PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Images | Ratings | Applications | Species | Date | Details | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
reviewed by:
Verified Customer |
Simple Western | Human | 04/06/2023 |
Summary
Comments
|
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
5 | |
4 | |
3 | |
2 | |
1 |
| Verified Customer 04/06/2023 |
||
| Application: | Simple Western | |
| Species: | Human |
| Gene Symbol | RPL28 |
![Immunocytochemistry/Immunofluorescence: RPL28 Antibody [NBP2-13254] - Immunofluorescent staining of human cell line MCF7 shows localization to cytosol & endoplasmic reticulum.](http://images.novusbio.com/fullsize/RPL28-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-13254-img0004.jpg "Immunocytochemistry/Immunofluorescence: RPL28 Antibody [NBP2-13254] - Immunofluorescent staining of human cell line MCF7 shows localization to cytosol & endoplasmic reticulum.")
![Immunohistochemistry-Paraffin: RPL28 Antibody [NBP2-13254] - Staining of human gastrointestinal shows moderate cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/RPL28-Antibody-Immunohistochemistry-Paraffin-NBP2-13254-img0009.jpg "Immunohistochemistry-Paraffin: RPL28 Antibody [NBP2-13254] - Staining of human gastrointestinal shows moderate cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: RPL28 Antibody [NBP2-13254] - Staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/RPL28-Antibody-Immunohistochemistry-Paraffin-NBP2-13254-img0007.jpg "Immunohistochemistry-Paraffin: RPL28 Antibody [NBP2-13254] - Staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: RPL28 Antibody [NBP2-13254] - Staining of human lymphoid tissues shows moderate cytoplasmic positivity in germinal center cells.](http://images.novusbio.com/fullsize/RPL28-Antibody-Immunohistochemistry-Paraffin-NBP2-13254-img0008.jpg "Immunohistochemistry-Paraffin: RPL28 Antibody [NBP2-13254] - Staining of human lymphoid tissues shows moderate cytoplasmic positivity in germinal center cells.")
![Immunohistochemistry-Paraffin: RPL28 Antibody [NBP2-13254] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.](http://images.novusbio.com/fullsize/RPL28-Antibody-Immunohistochemistry-Paraffin-NBP2-13254-img0010.jpg "Immunohistochemistry-Paraffin: RPL28 Antibody [NBP2-13254] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.")
![Immunocytochemistry TM4SF1/L6 Antibody (877621) [Unconjugated]](https://images.novusbio.com/images2/TM4SF1_MAB8164_Immunohistochemistry_19084.jpg)
![Flow Cytometry TM4SF1/L6 Antibody (877621) [Unconjugated]](https://images.novusbio.com/images2/TM4SF1_MAB8164_Flow_Cytometry_14781.jpg)
![Flow Cytometry TM4SF1/L6 Antibody (877621) [Unconjugated]](https://images.novusbio.com/images2/TM4SF1_MAB8164_Flow_Cytometry_14884.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
