![Western Blot: ROD1 Antibody (4C9) [H00009991-M01] - ROD1 monoclonal antibody (M01), clone 4C9 Analysis of ROD1 expression in Hela S3 NE.](http://images.novusbio.com/fullsize/ROD1-Antibody-4C9-Western-Blot-H00009991-M01-img0011.jpg "Western Blot: ROD1 Antibody (4C9) [H00009991-M01] - ROD1 monoclonal antibody (M01), clone 4C9 Analysis of ROD1 expression in Hela S3 NE.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ELISA, ICC/IF, IHC |
| Clone | 4C9 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Immunogen | ROD1 (NP_005147, 16 a.a. ~ 114 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GSDELLSSGIINGPFTMNSSTPSTANGNDSKKFKRDRPPCSPSRVLHLRKIPCDVTEAEIISLGLPFGKVTNLLMLKGKSQAFLEMASEEAAVTMVNYY |
| Specificity | ROD1 - ROD1 regulator of differentiation 1 (S. pombe) |
| Isotype | IgG1 Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | PTBP3 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence, immunohistochemistry (paraffin), and ELISA. |
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
![Simple Western Decorin Antibody [Unconjugated]](https://images.novusbio.com/images2/Decorin_AF1060_Simple_Western_18969.jpg)
![Western Blot Decorin Antibody [Unconjugated]](https://images.novusbio.com/images2/Decorin_AF1060_Western_Blot_19006.jpg)
![Immunohistochemistry Decorin Antibody [Unconjugated]](https://images.novusbio.com/images/af1060_mouse-decorin-affinity-purified-polyclonal-ab-8120255552891.jpg)
| Publication using H00009991-M01 | Applications | Species |
|---|---|---|
| Chen J, Cai Z, Bai M et al. The RNA-binding protein ROD1/PTBP3 cotranscriptionally defines AID-loading sites to mediate antibody class switch in mammalian genomes. Cell Res 2018-08-24 [PMID: 30143796] |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: ROD1 Antibody (4C9) [H00009991-M01] - Analysis of monoclonal antibody to ROD1 on HeLa cell. Antibody concentration 20 ug/ml.](http://images.novusbio.com/fullsize/ROD1-Antibody-4C9-Immunocytochemistry-Immunofluorescence-H00009991-M01-img0007.jpg "Immunocytochemistry/Immunofluorescence: ROD1 Antibody (4C9) [H00009991-M01] - Analysis of monoclonal antibody to ROD1 on HeLa cell. Antibody concentration 20 ug/ml.")
![Immunohistochemistry-Paraffin: ROD1 Antibody (4C9) [H00009991-M01] - Analysis of monoclonal antibody to ROD1 on formalin-fixed paraffin-embedded human small Intestine. Antibody concentration 3 ug/ml.](http://images.novusbio.com/fullsize/ROD1-Antibody-4C9-Immunohistochemistry-Paraffin-H00009991-M01-img0009.jpg "Immunohistochemistry-Paraffin: ROD1 Antibody (4C9) [H00009991-M01] - Analysis of monoclonal antibody to ROD1 on formalin-fixed paraffin-embedded human small Intestine. Antibody concentration 3 ug/ml.")
![Western Blot: ROD1 Antibody (4C9) [H00009991-M01] - ROD1 monoclonal antibody (M01), clone 4C9. Analysis of ROD1 expression in PC-12.](http://images.novusbio.com/fullsize/ROD1-Antibody-4C9-Western-Blot-H00009991-M01-img0010.jpg "Western Blot: ROD1 Antibody (4C9) [H00009991-M01] - ROD1 monoclonal antibody (M01), clone 4C9. Analysis of ROD1 expression in PC-12.")
![Western Blot: ROD1 Antibody (4C9) [H00009991-M01] - ROD1 monoclonal antibody (M01), clone 4C9. Analysis of ROD1 expression in NIH/3T3.](http://images.novusbio.com/fullsize/ROD1-Antibody-4C9-Western-Blot-H00009991-M01-img0012.jpg "Western Blot: ROD1 Antibody (4C9) [H00009991-M01] - ROD1 monoclonal antibody (M01), clone 4C9. Analysis of ROD1 expression in NIH/3T3.")
![Simple Western Thrombospondin-4 Antibody [Unconjugated]](https://images.novusbio.com/images2/Thrombospondin4_AF2390_Simple_Western_16991.jpg)
![Western Blot Thrombospondin-4 Antibody [Unconjugated]](https://images.novusbio.com/images2/Thrombospondin-4_AF2390_Western_Blot_11766.jpg)
![Immunocytochemistry/ Immunofluorescence Thrombospondin-4 Antibody [Unconjugated]](https://images.novusbio.com/images/af2390_human-thrombospondin-4-affinity-purified-polyclonal-ab-41202412403583.jpg)
![Knockout Validated STAT3 Antibody (232209) [Unconjugated]](https://images.novusbio.com/images2/STAT3_MAB1799_Simple_Western_21000.jpg)
![Western Blot STAT3 Antibody (232209) [Unconjugated]](https://images.novusbio.com/images2/STAT3_MAB1799_Western_Blot_5993.jpg)
![Knockout Validated STAT3 Antibody (232209) [Unconjugated]](https://images.novusbio.com/images2/STAT3_MAB1799_Knockout_Validated_21531.jpg)
![Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase-3_AF835_Immunocytochemistry_6532.jpg)
![Immunohistochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase3_AF835_Immunohistochemistry_22976.jpg)
![Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase-3_AF835_Immunocytochemistry_9340.jpg)
![Immunohistochemistry TFF2 Antibody (366508) [Unconjugated]](https://images.novusbio.com/images2/TFF2_MAB4077_Immunohistochemistry_21485.jpg)
![N/A Erythropoietin/EPO [HRP]](https://images.novusbio.com/images2/DATA_Erythropoietin_MEP00_ELISA_970.jpg)
![N/A Erythropoietin/EPO [HRP]](https://images.novusbio.com/images2/Erythropoietin_MEP00_ELISA_421.jpg)
![Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.](https://images.novusbio.com/images/Mouse-IgG1-Kappa-Light-Chain-Isotype-Control-P3-6-2-8-1-Flow-Cytometry-NBP1-43319-img0002.jpg "Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.")