Home » RNF111 » RNF111 Proteins » RNF111 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

RNF111 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for RNF111 Protein (NBP1-94140PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

RNF111 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RNF111.

Source: E. coli

Amino Acid Sequence: GTPSDEDNDSSFSDCLSSPSSSLHFGDSDTVTSDEDKEVSVRHSQTILNAKSRSHSARSHKWPRTETESVSGLLMKRPCLHGSSLRRLPC

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
RNF111
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-94140.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for RNF111 Recombinant Protein Antigen

  • ARK
  • Arkadia
  • DKFZp313E0731
  • DKFZp761D081
  • E3 ubiquitin-protein ligase Arkadia
  • EC 6.3.2
  • EC 6.3.2.-
  • FLJ38008
  • ring finger protein 111DKFZp686H1966

Background

RNF111 is encoded by this gene contains a RING finger domain, a motif known to be involved in protein-protein and protein-DNA interactions. The mouse counterpart of this gene (Rnf111/arkadia) has been shown to genetically interact with the transforming growth factor (TGF) beta-like factor Nodal, and act as a modulator of the nodal signaling cascade, which is essential for the induction of mesoderm during embryonic development.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Axl Antibody
[Unconjugated]
AF854
Immunohistochemistry Axl Antibody [Unconjugated]
(2 Reviews)
(56 Publications)
Species: Mu
Applications: IHC, WB
APAF-1 Antibody
(94408)
MAB868
Western Blot APAF-1 Antibody (94408)
(8 Publications)
Species: Hu
Applications: WB
SnoN Antibody -
BSA Free
NBP1-77306
Immunocytochemistry/ Immunofluorescence SnoN Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence SnoN Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence SnoN Antibody - BSA Free
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Smad7 Antibody
(293039) [Unconjugate
MAB2029
Western Blot Smad7 Antibody (293039) [Unconjugated]
Immunohistochemistry Smad7 Antibody (293039) [Unconjugated]
Immunohistochemistry Smad7 Antibody (293039) [Unconjugated]
(1 Review)
(59 Publications)
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
Dtk/TYRO3 Antibody
[Unconjugated]
AF759
Immunohistochemistry Dtk/TYRO3 Antibody [Unconjugated]
(13 Publications)
Species: Mu
Applications: IHC, WB
ZNF645 Antibody
NBP2-21037
Western Blot ZNF645 Antibody
Immunohistochemistry-Paraffin ZNF645 Antibody
Species: Hu
Applications: IHC, IHC-P, WB
MUL1 Antibody
(5H6.2D5) - BSA Free
NBP2-31361
Western Blot MUL1 Antibody (5H6.2D5) - BSA Free
Immunohistochemistry-Paraffin MUL1 Antibody (5H6.2D5) - BSA Free
Immunohistochemistry-Paraffin MUL1 Antibody (5H6.2D5) - BSA Free
Species: Hu
Applications: IHC, IHC-P, WB
TRIM50 Antibody
NBP1-81988
Immunohistochemistry-Paraffin TRIM50 Antibody
Species: Hu
Applications: IHC, IHC-P
Gas6 [Unconjugated]
885-GSB
Bioactivity Gas6 [Unconjugated]
(1 Review)
(38 Publications)
Species: Hu
Applications: BA
CHN 1 Antibody
(OTI2G6) - Azide and ...
NBP2-70411
Western Blot CHN 1 Antibody (OTI2G6) - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence CHN 1 Antibody (OTI2G6) - Azide and BSA Free
Immunohistochemistry CHN 1 Antibody (OTI2G6) - Azide and BSA Free
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
SKI Antibody - BSA
Free
NBP1-77305
Immunocytochemistry/ Immunofluorescence SKI Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence SKI Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence SKI Antibody - BSA Free
Species: Hu
Applications: ELISA, ICC/IF, WB
Smad2/3 Antibody
[Unconjugated]
AF3797
Western Blot Smad2/3 Antibody [Unconjugated]
Chromatin Immunoprecipitation (ChIP) Smad2/3 Antibody [Unconjugated]
Immunocytochemistry Smad2/3 Antibody [Unconjugated]
(1 Review)
(24 Publications)
Species: Hu, Mu
Applications: ChIP, ICC, IHC, Simple Western, WB
Smad3 Antibody
NB100-56479
Immunocytochemistry/ Immunofluorescence Smad3 Antibody
Western Blot Smad3 Antibody
Immunohistochemistry-Paraffin Smad3 Antibody
(5 Reviews)
(8 Publications)
Species: Bv, Ca, Hu, Mu, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Nodal
[Unconjugated]
3218-ND
Nodal [Unconjugated]
(22 Publications)
Species: Hu
Applications: BA
PrPC Antibody
NB100-56605
Western Blot PrPC Antibody
Species: Av, Bv, Sh
Applications: WB
FLASH Antibody -
BSA Free
NBP1-77301
Immunocytochemistry/ Immunofluorescence FLASH Antibody - BSA Free
Western Blot FLASH Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence FLASH Antibody - BSA Free
Species: Hu
Applications: ELISA, ICC/IF, WB
Rpn2 Antibody
NBP2-38323
Immunocytochemistry/ Immunofluorescence Rpn2 Antibody
Immunohistochemistry-Paraffin Rpn2 Antibody
Immunohistochemistry-Paraffin Rpn2 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
DIAPH1 Antibody
NB600-231
Immunohistochemistry-Paraffin DIAPH1 Antibody
Western Blot DIAPH1 Antibody
Western Blot DIAPH1 Antibody
(2 Publications)
Species: Hu
Applications: IHC, IHC-P, KD, WB
Desmoplakin
Antibody
NBP2-48836
Immunohistochemistry-Paraffin Desmoplakin Antibody
Immunohistochemistry-Paraffin Desmoplakin Antibody
Immunohistochemistry-Paraffin Desmoplakin Antibody
(2 Publications)
Species: Ca, Hu
Applications: ICC/IF, IHC, IHC-P
RNF111 Recombinant
Protein Antigen
NBP1-94140PEP
RNF111 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for RNF111 Protein (NBP1-94140PEP) (0)

There are no publications for RNF111 Protein (NBP1-94140PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RNF111 Protein (NBP1-94140PEP) (0)

There are no reviews for RNF111 Protein (NBP1-94140PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for RNF111 Protein (NBP1-94140PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RNF111 Products

Array NBP1-94140PEP

Research Areas for RNF111 Protein (NBP1-94140PEP)

Find related products by research area.

Blogs on RNF111

There are no specific blogs for RNF111, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Western blot shows lysates of H9 human cutaneous T lymphoma cell line, PT18 mouse mast/basophil cell line, and Rat-2 rat embryonic fibroblast cell line. PVDF membrane was probed with 1 µg/mL of Human/Mouse/Rat Smad7 Monoclonal Antibody (Catalog # MAB2029) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band was detected for Smad7 at approximately 50 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 2.
Smad7 Antibody (293039) [Unconjugated]
MAB2029
Axl was detected in immersion fixed paraffin-embedded sections of mouse kidney using Goat Anti-Mouse Axl Antigen Affinity-purified Polyclonal Antibody (Catalog # AF854) at 3 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Goat IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC004). Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to cell membranes in convoluted tubules. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
Axl Antibody [Unconjugated]
AF854
Recombinant Human Gas6 885-GSB down regulates the expression of Axl in DU145 human prostate carcinoma cells. The ED50 for this effect is 25-150 ng/mL.
Gas6 [Unconjugated]
885-GSB-050

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our RNF111 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol RNF111