![Western Blot: RNASE7 Antibody [NBP1-86134] - Analysis in control (vector only transfected HEK293T lysate) and rNASE7 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize/RNASE7-Antibody-Western-Blot-NBP1-86134-img0005.jpg "Western Blot: RNASE7 Antibody [NBP1-86134] - Analysis in control (vector only transfected HEK293T lysate) and rNASE7 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KGMTSSQWFKIQHMQPSPQACNSAMKNINKHTKRCKDLNTFLHEPFSSVAATCQTPKIACKNGDKNCHQSHGPVSLTMCKLTSGKYPNCRYKEKRQNKSYVVACKPPQKKDSQQFHLVPVHLDRV |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | RNASE7 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for RNASE7 Antibody (NBP1-86134)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | RNASE7 |
![Immunohistochemistry-Paraffin: RNASE7 Antibody [NBP1-86134] - Staining of human skin shows weak cytoplasmic positivity in squamous epithelial cells.](http://images.novusbio.com/fullsize/antibody/nbp1-86134_rabbit-polyclonal-rnase7-antibody-immunohistochemistry-paraffin-1112024101959..jpg "Immunohistochemistry-Paraffin: RNASE7 Antibody [NBP1-86134] - Staining of human skin shows weak cytoplasmic positivity in squamous epithelial cells.")
![Immunohistochemistry-Paraffin: RNASE7 Antibody [NBP1-86134] -Staining of human colon shows moderate cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/antibody/nbp1-86134_rabbit-polyclonal-rnase7-antibody-immunohistochemistry-paraffin-1112024102054..jpg "Immunohistochemistry-Paraffin: RNASE7 Antibody [NBP1-86134] -Staining of human colon shows moderate cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: RNASE7 Antibody [NBP1-86134] - Staining of human fallopian tube shows no positivity in glandular cells as expected.](http://images.novusbio.com/fullsize/antibody/nbp1-86134_rabbit-polyclonal-rnase7-antibody-immunohistochemistry-paraffin-1112024102210..jpg "Immunohistochemistry-Paraffin: RNASE7 Antibody [NBP1-86134] - Staining of human fallopian tube shows no positivity in glandular cells as expected.")
![Immunohistochemistry-Paraffin: RNASE7 Antibody [NBP1-86134] -Staining of human endometrium shows no positivity in glandular cells as expected.](http://images.novusbio.com/fullsize/antibody/nbp1-86134_rabbit-polyclonal-rnase7-antibody-immunohistochemistry-paraffin-1112024102319..jpg "Immunohistochemistry-Paraffin: RNASE7 Antibody [NBP1-86134] -Staining of human endometrium shows no positivity in glandular cells as expected.")
![Immunocytochemistry PSAP Antibody [Unconjugated]](https://images.novusbio.com/images2/PSAP_AF8520_Immunocytochemistry_16563.jpg)
![Western Blot PSAP Antibody [Unconjugated]](https://images.novusbio.com/images2/PSAP_AF8520_Western_Blot_16593.jpg)
![Simple Western PSAP Antibody [Unconjugated]](https://images.novusbio.com/images2/af8520_human-psap-affinity-purified-polyclonal-ab-simple-western-13420221645.jpg)
![N/A Angiogenin [HRP]](https://images.novusbio.com/images2/Angiogenin_DAN00_ELISA_28.jpg)
![N/A Angiogenin [HRP]](https://images.novusbio.com/images2/DATA_Angiogenin_DAN00_ELISA_571.jpg)
![Simple Western Glucosylceramidase/GBA Antibody (812201) [Unconjugated]](https://images.novusbio.com/images2/16239.jpg)
![Western Blot Glucosylceramidase/GBA Antibody (812201) [Unconjugated]](https://images.novusbio.com/images2/Glucosylceramidase_MAB7410_Western_Blot_12708.jpg)
![Immunocytochemistry Glucosylceramidase/GBA Antibody (812201) [Unconjugated]](https://images.novusbio.com/images2/Glucosylceramidase_MAB7410_Immunocytochemistry_12732.jpg)
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![Western Blot Pentraxin 2/SAP Antibody [Unconjugated]](https://images.novusbio.com/images2/Pentraxin_2_AF2558_Western_Blot_15557.jpg)
![Simple Western Pentraxin 2/SAP Antibody [Unconjugated]](https://images.novusbio.com/images2/Pentraxin_2_AF2558_Simple_Western_17977.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")