| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, MA, AP |
| Description | A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1-98 of Human Rictor Source: Wheat Germ (in vitro) Amino Acid Sequence: MAAIGRGRSLKNLRVRGRNDSGEENVPLDLTREPSDNLREILQNVARLQGVSNMRKLGHLNNFTKLLCDIGHSEEKLGFHYEDIIICLRLALLNEAKE |
| Preparation Method |
in vitro wheat germ expression system |
| Details of Functionality | This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated. |
| Source | Wheat germ |
| Protein/Peptide Type | Partial Recombinant Protein |
| Gene | RICTOR |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
| Dilutions |
|
| Theoretical MW | 36.52 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -80C. Avoid freeze-thaw cycles. |
| Buffer | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
| Preservative | No Preservative |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
![Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Western_Blot_5930.jpg)
![Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/16332.jpg)
![Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Flow_Cytometry_8283.jpg)
Research Areas for Rictor Partial Recombinant Protein (H00253260-Q01)Find related products by research area.
|
|
mTOR - a central regulator of cell metabolism The mammalian target of rapamycin (mTOR) signaling pathway allows cells to monitor environmental signals like nutrient availability and oxygen levels. mTOR is a phosphoinositide 3-kinase (PI3K)-related protein that assembles into large protein comp... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | RICTOR |
![Immunohistochemistry-Paraffin TOR/mTOR [p Ser2448] Antibody](https://images.novusbio.com/images/TOR-mTOR-[p-Ser2448]-Antibody-Immunohistochemistry-Paraffin-NB600-607-img0005.jpg)
![Western Blot TOR/mTOR [p Ser2448] Antibody](https://images.novusbio.com/images/TOR-mTOR-[p-Ser2448]-Antibody-Western-Blot-NB600-607-img0006.jpg)
![Data TOR/mTOR [p Ser2448] Antibody](https://images.novusbio.com/images/TOR-mTOR-[p-Ser2448]-Antibody-N-A-NB600-607-img0008.jpg)
![Bioactivity GM-CSF [Unconjugated]](https://images.novusbio.com/images/protein/7954-gmcf_recombinant-human-gm-csf-cho-expressed-protein-cf-bioactivity-272020121514.jpg)
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Simple Western PYK2/FAK2 [p Tyr402] Antibody (592918) [Unconjugated]](https://images.novusbio.com/images2/PYK2_MAB6210_Simple_Western_16639.jpg)
![Western Blot PYK2/FAK2 [p Tyr402] Antibody (592918) [Unconjugated]](https://images.novusbio.com/images2/PYK2_MAB6210_Western_Blot_9430.jpg)
![Immunocytochemistry/ Immunofluorescence p70 S6 Kinase/S6K [p Thr389/412] Antibody](https://images.novusbio.com/images/p70-S6-Kinase-S6K-[p-Thr389]-Antibody-Immunocytochemistry-Immunofluorescence-NB600-1049-img0002.jpg)
![Immunohistochemistry p70 S6 Kinase/S6K [p Thr389/412] Antibody](https://images.novusbio.com/images/p70-S6-Kinase-S6K-[p-Thr389]-Antibody-Immunohistochemistry-NB600-1049-img0003.jpg)
![Western Blot p70 S6 Kinase/S6K [p Thr389/412] Antibody](https://images.novusbio.com/images/p70-S6-Kinase-S6K-[p-Thr389]-Antibody-Western-Blot-NB600-1049-img0004.jpg)
![Western Blot GBL Antibody [Unconjugated]](https://images.novusbio.com/images2/GBL_AF4004_Western_Blot_5381.jpg)
![Immunohistochemistry GBL Antibody [Unconjugated]](https://images.novusbio.com/images2/GBL_AF4004_Immunohistochemistry_19617.jpg)
![Flow Cytometry: Rictor Antibody (7B3) [NBP1-51645] - Flow cytometric analysis of Hela cells using RICTOR mouse mAb (green) and negative control (purple).](https://images.novusbio.com/images/Rictor-Antibody-7B3-Flow-Cytometry-NBP1-51645-img0005.jpg "Flow Cytometry: Rictor Antibody (7B3) [NBP1-51645] - Flow cytometric analysis of Hela cells using RICTOR mouse mAb (green) and negative control (purple).")