![Immunohistochemistry-Paraffin: RIAM/APBB1IP Antibody [NBP2-39009] - Analysis in human lymph node and heart muscle tissues. Corresponding RIAM/APBB1IP RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/RIAM-APBB1IP-Antibody-Immunohistochemistry-Paraffin-NBP2-39009-img0007.jpg "Immunohistochemistry-Paraffin: RIAM/APBB1IP Antibody [NBP2-39009] - Analysis in human lymph node and heart muscle tissues. Corresponding RIAM/APBB1IP RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: KTLYDNYQRAVAKAGLASRWTNLGTVNAAAPAQPSTGPKTGTTQPNGQIPQATHSVSAVLQEAQRHAETSKDKKPAL |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | APBB1IP |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot FYB/ADAP/SLAP130 Antibody [Unconjugated]](https://images.novusbio.com/images2/SLAP-130_AF3857_Western_Blot_5357.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: RIAM/APBB1IP Antibody [NBP2-39009] - Staining of human cerebral cortex, colon, heart muscle and lymph node using Anti-RIAM/APBB1IP antibody NBP2-39009 (A) shows similar protein distribution across tissues to independent antibody NBP2-14300 (B).](http://images.novusbio.com/fullsize/RIAM-APBB1IP-Antibody-Immunohistochemistry-Paraffin-NBP2-39009-img0011.jpg "Immunohistochemistry-Paraffin: RIAM/APBB1IP Antibody [NBP2-39009] - Staining of human cerebral cortex, colon, heart muscle and lymph node using Anti-RIAM/APBB1IP antibody NBP2-39009 (A) shows similar protein distribution across tissues to independent antibody NBP2-14300 (B).")
![Immunocytochemistry/Immunofluorescence: RIAM/APBB1IP Antibody [NBP2-39009] - Immunofluorescent staining of human cell line BJ shows localization to plasma membrane & cytosol.](http://images.novusbio.com/fullsize/RIAM-APBB1IP-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-39009-img0002.jpg "Immunocytochemistry/Immunofluorescence: RIAM/APBB1IP Antibody [NBP2-39009] - Immunofluorescent staining of human cell line BJ shows localization to plasma membrane & cytosol.")
![Immunohistochemistry-Paraffin: RIAM/APBB1IP Antibody [NBP2-39009] - Staining of human lymph node shows very strong cytoplasmic positivity in germinal center cells.](http://images.novusbio.com/fullsize/RIAM-APBB1IP-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-39009-img0013.jpg "Immunohistochemistry-Paraffin: RIAM/APBB1IP Antibody [NBP2-39009] - Staining of human lymph node shows very strong cytoplasmic positivity in germinal center cells.")
![Immunohistochemistry-Paraffin: RIAM/APBB1IP Antibody [NBP2-39009] - Staining of human cerebral cortex shows strong cytoplasmic positivity in glial cells.](http://images.novusbio.com/fullsize/RIAM-APBB1IP-Antibody-Immunohistochemistry-Paraffin-NBP2-39009-img0008.jpg "Immunohistochemistry-Paraffin: RIAM/APBB1IP Antibody [NBP2-39009] - Staining of human cerebral cortex shows strong cytoplasmic positivity in glial cells.")
![Immunohistochemistry-Paraffin: RIAM/APBB1IP Antibody [NBP2-39009] - Staining of human colon shows strong cytoplasmic positivity in lymphoid cells.](http://images.novusbio.com/fullsize/RIAM-APBB1IP-Antibody-Immunohistochemistry-Paraffin-NBP2-39009-img0010.jpg "Immunohistochemistry-Paraffin: RIAM/APBB1IP Antibody [NBP2-39009] - Staining of human colon shows strong cytoplasmic positivity in lymphoid cells.")
![Immunohistochemistry-Paraffin: RIAM/APBB1IP Antibody [NBP2-39009] - Staining of human heart muscle shows no positivity in cardiomyocytes as expected.](http://images.novusbio.com/fullsize/RIAM-APBB1IP-Antibody-Immunohistochemistry-Paraffin-NBP2-39009-img0012.jpg "Immunohistochemistry-Paraffin: RIAM/APBB1IP Antibody [NBP2-39009] - Staining of human heart muscle shows no positivity in cardiomyocytes as expected.")
![Western Blot Rap1A/B Antibody [Unconjugated]](https://images.novusbio.com/images2/Rap1B_AF3767_Western_Blot_5331.jpg)
![Western Blot Rap1A/B Antibody [Unconjugated]](https://images.novusbio.com/images2/Rap1B_AF3767_Western_Blot_6316.jpg)
![Immunohistochemistry Rap1A/B Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af3767_human-mouse-rat-rap1a-b-affinity-purified-polyclonal-ab-immunohistochemistry-318202392533..jpg)
![Immunocytochemistry Integrin beta 2/CD18 Antibody [Unconjugated]](https://images.novusbio.com/images2/Integrin_beta_2_AF1730_Immunocytochemistry_6474.jpg)
![Immunocytochemistry Integrin beta 2/CD18 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af1730_human-integrin-beta-2-cd18-affinity-purified-polyclonal-ab-immunocytochemistry-1292023225343.jpg)
![Western Blot Integrin alpha L/CD11a Antibody (345913) [Unconjugated]](https://images.novusbio.com/images2/Integrin_alpha_L_MAB3595_Western_Blot_10266.jpg)
![Simple Western Integrin alpha L/CD11a Antibody (345913) [Unconjugated]](https://images.novusbio.com/images2/mab3595_human-integrin-alpha-l-cd11a-mab-clone-345913-simple-western-268202215744.jpg)
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![Western Blot Src [p Tyr419] Antibody [Unconjugated]](https://images.novusbio.com/images2/Src_AF2685_Western_Blot_5209.jpg)
![Simple Western Src [p Tyr419] Antibody [Unconjugated]](https://images.novusbio.com/images2/16327.jpg)
![Immunohistochemistry Src [p Tyr419] Antibody [Unconjugated]](https://images.novusbio.com/images2/Src_AF2685_Immunohistochemistry_7158.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")