![Immunohistochemistry-Paraffin: LRPAP Antibody [NBP1-89334] - Staining in human placenta and skeletal muscle tissues.. Corresponding LRPAP1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/LRPAP-Antibody-Immunohistochemistry-Paraffin-NBP1-89334-img0025.jpg "Immunohistochemistry-Paraffin: LRPAP Antibody [NBP1-89334] - Staining in human placenta and skeletal muscle tissues.. Corresponding LRPAP1 RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RMEKLNQLWEKAQRLHLPPVRLAELHADLKIQERDELAWKKLKLDGLDEDGEKEARLIRNLNVILAKYGLDGKKDARQVTSNSLSGTQEDGLDDPRLEKLWHKAKTSGKFSGEELDKLWREFLHHKEK |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | LRPAP1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | LRPAP1 |
![Western Blot: LRPAP Antibody [NBP1-89334] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10 Lane 2: Mouse Cerebral Cortex tissue](http://images.novusbio.com/fullsize/LRPAP-Antibody-Western-Blot-NBP1-89334-img0015.jpg "Western Blot: LRPAP Antibody [NBP1-89334] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10 Lane 2: Mouse Cerebral Cortex tissue")
![Immunocytochemistry/Immunofluorescence: LRPAP Antibody [NBP1-89334] - Staining of human cell line A-431 shows localization to endoplasmic reticulum. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/LRPAP-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89334-img0017.jpg "Immunocytochemistry/Immunofluorescence: LRPAP Antibody [NBP1-89334] - Staining of human cell line A-431 shows localization to endoplasmic reticulum. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: LRPAP Antibody [NBP1-89334] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.](http://images.novusbio.com/fullsize/LRPAP-Antibody-Immunohistochemistry-Paraffin-NBP1-89334-img0030.jpg "Immunohistochemistry-Paraffin: LRPAP Antibody [NBP1-89334] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.")
![Western Blot: LRPAP Antibody [NBP1-89334] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp](http://images.novusbio.com/fullsize/LRPAP-Antibody-Western-Blot-NBP1-89334-img0005.jpg "Western Blot: LRPAP Antibody [NBP1-89334] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp")
![Western Blot: LRPAP Antibody [NBP1-89334] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells); Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells).](http://images.novusbio.com/fullsize/LRPAP-Antibody-Western-Blot-NBP1-89334-img0004.jpg "Western Blot: LRPAP Antibody [NBP1-89334] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells); Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells).")
![Western Blot: LRPAP Antibody [NBP1-89334] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human Cerebral Cortex tissue](http://images.novusbio.com/fullsize/LRPAP-Antibody-Western-Blot-NBP1-89334-img0009.jpg "Western Blot: LRPAP Antibody [NBP1-89334] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human Cerebral Cortex tissue")
![Immunohistochemistry-Paraffin: LRPAP Antibody [NBP1-89334] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.](http://images.novusbio.com/fullsize/LRPAP-Antibody-Immunohistochemistry-Paraffin-NBP1-89334-img0018.jpg "Immunohistochemistry-Paraffin: LRPAP Antibody [NBP1-89334] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.")
![Immunohistochemistry: LRPAP Antibody [NBP1-89334] - Immunofluorescence staining of mouse hypothalamus shows positivity in paraventricular and periventricular nuclei.](http://images.novusbio.com/fullsize/LRPAP-Antibody-Immunohistochemistry-Paraffin-NBP1-89334-img0019.jpg "Immunohistochemistry: LRPAP Antibody [NBP1-89334] - Immunofluorescence staining of mouse hypothalamus shows positivity in paraventricular and periventricular nuclei.")
![Immunohistochemistry-Paraffin: LRPAP Antibody [NBP1-89334] - Staining of human hippocampus shows moderate cytoplasmic positivity in neuronal cells.](http://images.novusbio.com/fullsize/LRPAP-Antibody-Immunohistochemistry-Paraffin-NBP1-89334-img0020.jpg "Immunohistochemistry-Paraffin: LRPAP Antibody [NBP1-89334] - Staining of human hippocampus shows moderate cytoplasmic positivity in neuronal cells.")
![Immunohistochemistry: LRPAP Antibody [NBP1-89334] - Immunofluorescence staining of mouse brain shows positivity in neurons in the olfactory bulb.](http://images.novusbio.com/fullsize/LRPAP-Antibody-Immunohistochemistry-Paraffin-NBP1-89334-img0021.jpg "Immunohistochemistry: LRPAP Antibody [NBP1-89334] - Immunofluorescence staining of mouse brain shows positivity in neurons in the olfactory bulb.")
![Immunohistochemistry-Paraffin: LRPAP Antibody [NBP1-89334] - Staining of human skeletal muscle shows weak to no positivity in myocytes as expected.](http://images.novusbio.com/fullsize/LRPAP-Antibody-Immunohistochemistry-Paraffin-NBP1-89334-img0022.jpg "Immunohistochemistry-Paraffin: LRPAP Antibody [NBP1-89334] - Staining of human skeletal muscle shows weak to no positivity in myocytes as expected.")
![Immunohistochemistry-Paraffin: LRPAP Antibody [NBP1-89334] - Staining of human placenta shows strong positivity in trophoblastic cells.](http://images.novusbio.com/fullsize/LRPAP-Antibody-Immunohistochemistry-Paraffin-NBP1-89334-img0023.jpg "Immunohistochemistry-Paraffin: LRPAP Antibody [NBP1-89334] - Staining of human placenta shows strong positivity in trophoblastic cells.")
![Immunohistochemistry: LRPAP Antibody [NBP1-89334] - Staining of mouse piriform cortex shows positivity in neurons.](http://images.novusbio.com/fullsize/LRPAP-Antibody-Immunohistochemistry-NBP1-89334-img0028.jpg "Immunohistochemistry: LRPAP Antibody [NBP1-89334] - Staining of mouse piriform cortex shows positivity in neurons.")
![Immunohistochemistry: LRPAP Antibody [NBP1-89334] - Staining of mouse somatosensory cortex shows positivity in neurons.](http://images.novusbio.com/fullsize/LRPAP-Antibody-Immunohistochemistry-NBP1-89334-img0029.jpg "Immunohistochemistry: LRPAP Antibody [NBP1-89334] - Staining of mouse somatosensory cortex shows positivity in neurons.")
![Western Blot Rap1A/B Antibody [Unconjugated]](https://images.novusbio.com/images2/Rap1B_AF3767_Western_Blot_5331.jpg)
![Western Blot Rap1A/B Antibody [Unconjugated]](https://images.novusbio.com/images2/Rap1B_AF3767_Western_Blot_6316.jpg)
![Immunohistochemistry Rap1A/B Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af3767_human-mouse-rat-rap1a-b-affinity-purified-polyclonal-ab-immunohistochemistry-318202392533..jpg)
![Immunohistochemistry LDLR Antibody [Unconjugated]](https://images.novusbio.com/images2/LDL_R_AF2255_Immunohistochemistry_7149.jpg)
![Western Blot LDLR Antibody [Unconjugated]](https://images.novusbio.com/images2/LDLR_AF2255_Western_Blot_23731.jpg)
![Western Blot LDLR Antibody [Unconjugated]](https://images.novusbio.com/images/af2255_mouse-ldl-r-affinity-purified-polyclonal-ab-4120241049445.jpg)
![Western Blot Prostatic Acid Phosphatase/ACPP Antibody [Unconjugated]](https://images.novusbio.com/images2/Prostatic_Acid_Phosphatase_AF6240_Western_Blot_10680.jpg)
![Immunohistochemistry Prostatic Acid Phosphatase/ACPP Antibody [Unconjugated]](https://images.novusbio.com/images2/Prostatic_Acid_Phosphatase_AF6240_Immunohistochemistry_10732.jpg)
![ELISA Prostatic Acid Phosphatase/ACPP Antibody [Unconjugated]](https://images.novusbio.com/images2/Prostatic_Acid_Phosphatase_AF6240_ELISA_22233.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")