![Western Blot: RGL2 Antibody (4D10) [H00005863-M02] - Impact of RGL2 depletion on RalB activation at autophagosomes upon starvation. Validation of RGL2 depletions. Representative western blots for RGL2 and GAPDH from cell lysates of HEK-HT cells prepared 72 hrs after transfection with the indicated siRNAs. Quantifications of RGL2 protein depletion, normalized for siControl condition (=100), are shown below the WB. Image collected and cropped by CiteAb from the following publication (//www.nature.com/articles/s41598-019-45443-1), licensed under a CC-BY license.](http://images.novusbio.com/fullsize/RGL2-Antibody-4D10-Western-Blot-H00005863-M02-img0009.jpg "Western Blot: RGL2 Antibody (4D10) [H00005863-M02] - Impact of RGL2 depletion on RalB activation at autophagosomes upon starvation. Validation of RGL2 depletions. Representative western blots for RGL2 and GAPDH from cell lysates of HEK-HT cells prepared 72 hrs after transfection with the indicated siRNAs. Quantifications of RGL2 protein depletion, normalized for siControl condition (=100), are shown below the WB. Image collected and cropped by CiteAb from the following publication (//www.nature.com/articles/s41598-019-45443-1), licensed under a CC-BY license.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, ICC/IF |
| Clone | 4D10 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Description | Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen | RGL2 (AAH32681, 644 a.a. ~ 743 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PGASDCRIIRVQMELGEDGSVYKSILVTSQDKAPSVISRVLKKNNRDSAVASEYELVQLLPGERELTIPASANVFYAMDGASHDFLLRQRRRSSTATPGV |
| Specificity | RGL2 - ral guanine nucleotide dissociation stimulator-like 2 |
| Isotype | IgG1 |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | RGL2 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF and ELISA. |
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
![Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Western_Blot_5930.jpg)
![Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/16332.jpg)
![Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Flow_Cytometry_8283.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for RGL2 Antibody (H00005863-M02)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: RGL2 Antibody (4D10) [H00005863-M02] - Analysis of monoclonal antibody to RGL2 on HeLa cell. Antibody concentration 10 ug/ml.](http://images.novusbio.com/fullsize/RGL2-Antibody-4D10-Immunocytochemistry-Immunofluorescence-H00005863-M02-img0005.jpg "Immunocytochemistry/Immunofluorescence: RGL2 Antibody (4D10) [H00005863-M02] - Analysis of monoclonal antibody to RGL2 on HeLa cell. Antibody concentration 10 ug/ml.")
![Western Blot: RGL2 Antibody (4D10) [H00005863-M02] - RGL2 monoclonal antibody (M02), clone 4D10 Analysis of RGL2 expression in HeLa.](http://images.novusbio.com/fullsize/RGL2-Antibody-4D10-Western-Blot-H00005863-M02-img0007.jpg "Western Blot: RGL2 Antibody (4D10) [H00005863-M02] - RGL2 monoclonal antibody (M02), clone 4D10 Analysis of RGL2 expression in HeLa.")
![ELISA: RGL2 Antibody (4D10) [H00005863-M02] - Detection limit for recombinant GST tagged RGL2 is approximately 1ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/RGL2-Antibody-4D10-ELISA-H00005863-M02-img0008.jpg "ELISA: RGL2 Antibody (4D10) [H00005863-M02] - Detection limit for recombinant GST tagged RGL2 is approximately 1ng/ml as a capture antibody.")
![Western Blot SOS2 Antibody [Unconjugated]](https://images.novusbio.com/images2/SOS2_AF6260_Western_Blot_9542.jpg)
![Western Blot Raf-1 Antibody (563002) [Unconjugated]](https://images.novusbio.com/images2/Raf-1_MAB4540_Western_Blot_9426.jpg)
![Immunohistochemistry Raf-1 Antibody (563002) [Unconjugated]](https://images.novusbio.com/images2/Raf-1_MAB4540_Immunohistochemistry_9891.jpg)
![Simple Western Raf-1 Antibody (563002) [Unconjugated]](https://images.novusbio.com/images2/mab4540_human-mouse-rat-raf-1-mab-clone-563002-simple-western-158202212919.jpg)
![SDS-PAGE LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_719.jpg)
![Bioactivity LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_721.jpg)
![SDS-Page: Mouse IgG1 Isotype Control (MG1) [NBP1-97005] - Lane 1: , Non-reduced. M: Opal Pre-stained Ladder. Lane 2: , Reduced. Load: 1.0 ug per lane. Predicted/Observed: 120 kDa Non-reduced, 55 and 25 Reduced.](https://images.novusbio.com/images/Mouse-IgG1-Isotype-Control-MG1-SDS-Page-NBP1-97005-img0002.jpg "SDS-Page: Mouse IgG1 Isotype Control (MG1) [NBP1-97005] - Lane 1: , Non-reduced. M: Opal Pre-stained Ladder. Lane 2: , Reduced. Load: 1.0 ug per lane. Predicted/Observed: 120 kDa Non-reduced, 55 and 25 Reduced.")