![Immunohistochemistry-Paraffin: RBM6 Antibody (3E9) [H00010180-M02] - Analysis of monoclonal antibody to RBM6 on formalin-fixed paraffin-embedded human prostate. Antibody concentration 3 ug/ml.](http://images.novusbio.com/fullsize/RBM6-Antibody-3E9-Immunohistochemistry-Paraffin-H00010180-M02-img0003.jpg "Immunohistochemistry-Paraffin: RBM6 Antibody (3E9) [H00010180-M02] - Analysis of monoclonal antibody to RBM6 on formalin-fixed paraffin-embedded human prostate. Antibody concentration 3 ug/ml.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, IHC |
| Clone | 3E9 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Immunogen | RBM6 (NP_005768.1, 1024 a.a. ~ 1123 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DSPERKRIKYSRETDSDRKLVDKEDIDTSSKGGCVQQATGWRKGTGLGYGHPGLASSEEAEGRMRGPSVGASGRTSKRQSNETYRDAVRRVMFARYKELD |
| Specificity | RBM6 - RNA binding motif protein 6 (3E9) |
| Isotype | IgG2a Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | RBM6 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Sandwich ELISA: RBM6 Antibody (3E9) [H00010180-M02] - Detection limit for recombinant GST tagged RBM6 is approximately 0.03ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/RBM6-Antibody-3E9-Sandwich-ELISA-H00010180-M02-img0004.jpg "Sandwich ELISA: RBM6 Antibody (3E9) [H00010180-M02] - Detection limit for recombinant GST tagged RBM6 is approximately 0.03ng/ml as a capture antibody.")
![Bioactivity CTLA-4 [Unconjugated]](https://images.novusbio.com/images2/CTLA4_7268CT_2293.jpg)
![Western Blot Raf-1 Antibody (563002) [Unconjugated]](https://images.novusbio.com/images2/Raf-1_MAB4540_Western_Blot_9426.jpg)
![Immunohistochemistry Raf-1 Antibody (563002) [Unconjugated]](https://images.novusbio.com/images2/Raf-1_MAB4540_Immunohistochemistry_9891.jpg)
![Simple Western Raf-1 Antibody (563002) [Unconjugated]](https://images.novusbio.com/images2/mab4540_human-mouse-rat-raf-1-mab-clone-563002-simple-western-158202212919.jpg)
