![Western Blot: RABL4 Antibody [NBP1-87170] - Analysis in human cell lines HEK293 and Caco-2 using anti-IFT27 antibody. Corresponding IFT27 RNA-seq data are presented for the same cell lines. Loading control: anti-COX4I1.](http://images.novusbio.com/fullsize/RABL4-Antibody-Western-Blot-NBP1-87170-img0009.jpg "Western Blot: RABL4 Antibody [NBP1-87170] - Analysis in human cell lines HEK293 and Caco-2 using anti-IFT27 antibody. Corresponding IFT27 RNA-seq data are presented for the same cell lines. Loading control: anti-COX4I1.")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: TNEESFNNCSKWLEKARSQAPGISLPGVLVGNKTDLAGRRAVDSAEARAWALGQGLECFETSVKEMENFEAPFHCLAKQFHQLYREKVEV |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | IFT27 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Myoglobin Antibody [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Myoglobin Antibody [Unconjugated]")
Secondary Antibodies |
Isotype Controls |
Research Areas for RABL4 Antibody (NBP1-87170)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | IFT27 |
![Western Blot: RABL4 Antibody [NBP1-87170] - IFT proteins associate with central spindle MTs in anaphase and are required for their organization. Western blots (left) showing the amount of IFT27 and IFT88 in LLC-PK1 cells transfected with control (CT), IFT27 or IFT88 siRNA. alpha-tubulin: loading control. Immunofluorescence images (right) showing a decrease of IFT88 staining in an anaphase cell upon IFT88 depletion. Scale bars: 10?um for main images, 3?um for insets. Image collected and cropped by CiteAb from the following publication (//www.nature.com/articles/s41467-017-01479-3), licensed under a CC-BY license.](http://images.novusbio.com/fullsize/RABL4-Antibody-Western-Blot-NBP1-87170-img0011.jpg "Western Blot: RABL4 Antibody [NBP1-87170] - IFT proteins associate with central spindle MTs in anaphase and are required for their organization. Western blots (left) showing the amount of IFT27 and IFT88 in LLC-PK1 cells transfected with control (CT), IFT27 or IFT88 siRNA. alpha-tubulin: loading control. Immunofluorescence images (right) showing a decrease of IFT88 staining in an anaphase cell upon IFT88 depletion. Scale bars: 10?um for main images, 3?um for insets. Image collected and cropped by CiteAb from the following publication (//www.nature.com/articles/s41467-017-01479-3), licensed under a CC-BY license.")
![Western Blot: RABL4 Antibody [NBP1-87170] - Analysis in control (vector only transfected HEK293T lysate) and IFT27 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize/RABL4-Antibody-Western-Blot-NBP1-87170-img0010.jpg "Western Blot: RABL4 Antibody [NBP1-87170] - Analysis in control (vector only transfected HEK293T lysate) and IFT27 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
![Western Blot: RABL4 Antibody [NBP1-87170] - IFT proteins are required for the timely relocalization of the kinase Aurora B to the central spindle. Myc immunoprecipitation performed on mitotic HeLa Kyoto cells transfected with Myc or with Myc-Aurora B. Image collected and cropped by CiteAb from the following publication (//www.nature.com/articles/s41467-017-01479-3), licensed under a CC-BY license.](http://images.novusbio.com/fullsize/RABL4-Antibody-Western-Blot-NBP1-87170-img0012.jpg "Western Blot: RABL4 Antibody [NBP1-87170] - IFT proteins are required for the timely relocalization of the kinase Aurora B to the central spindle. Myc immunoprecipitation performed on mitotic HeLa Kyoto cells transfected with Myc or with Myc-Aurora B. Image collected and cropped by CiteAb from the following publication (//www.nature.com/articles/s41467-017-01479-3), licensed under a CC-BY license.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")