Rab1A Antibody - Azide and BSA Free Summary
Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 1-205 of human Rab1A (NP_004152.1). MSSMNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRMGPGATAGGAEKSNVKIQSTPVKQSGGGCC |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
RAB1A |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/ Immunofluorescence 1:50-1:200
- Western Blot 1:500 - 1:1000
|
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.3), 50% glycerol |
Preservative |
0.05% Proclin 300 |
Purity |
Affinity purified |
Alternate Names for Rab1A Antibody - Azide and BSA Free
Background
The small GTPase RAB1 controls vesicle traffic from the endoplasmic reticulum (ER) to the Golgi apparatus. Rab1 belongs to the Ras superfamily of GTPases that cycle between inactive GDP-bound and active GTP-bound forms (Allan et al., 2000 [PubMed 10903204]).[supplied by OMIM]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, WB
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Bv, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC-FrFl, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Ze
Applications: ELISA, ICC/IF, IHC, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Pm, Mu, Pm
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB
Species: Ca, Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu, Rt
Applications: WB
Publications for Rab1A Antibody (NBP2-94057) (0)
There are no publications for Rab1A Antibody (NBP2-94057).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Rab1A Antibody (NBP2-94057) (0)
There are no reviews for Rab1A Antibody (NBP2-94057).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Rab1A Antibody (NBP2-94057) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Rab1A Products
Research Areas for Rab1A Antibody (NBP2-94057)
Find related products by research area.
|
Blogs on Rab1A