![Western Blot: PTRH2 Antibody [NBP1-88595] - Analysis in human cell line A-549.](http://images.novusbio.com/fullsize/PTRH2-Antibody-Western-Blot-NBP1-88595-img0012.jpg "Western Blot: PTRH2 Antibody [NBP1-88595] - Analysis in human cell line A-549.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KSKTSKTHTDTESEASILGDSGEYKMILVVRNDLKMGKGKVAAQCSHAAVSAYKQIQRRNPEMLKQWEYCGQPKVVVKAPDEETLIALLAHAKMLGLTVSLIQDAGRTQIAPGSQTVLGIGPGPADLIDKVTGHLKL |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PTRH2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunohistochemistry PTH Antibody (918462) [Unconjugated]](https://images.novusbio.com/images2/PTH_MAB7665_Immunohistochemistry_16650.jpg)
![Western Blot PTH Antibody (918462) [Unconjugated]](https://images.novusbio.com/images2/PTH_MAB7665_Western_Blot_16656.jpg)
![Western Blot PTEN Antibody [Unconjugated]](https://images.novusbio.com/images2/PTEN_AF847_Western_Blot_5922.jpg)
![Simple Western PTEN Antibody [Unconjugated]](https://images.novusbio.com/images2/16342.jpg)
![Knockout Validated PTEN Antibody [Unconjugated]](https://images.novusbio.com/images2/PTEN_AF847_Knockout_Validated_22996.jpg)
![Simple Western EphB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphB2_AF467_Simple_Western_21454.jpg)
![Western Blot EphB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphB2_AF467_Western_Blot_21511.jpg)
![Immunocytochemistry EphB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphB2_AF467_Immunocytochemistry__Immunofluorescence_17288.jpg)
![Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Western_Blot_5930.jpg)
![Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/16332.jpg)
![Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Flow_Cytometry_8283.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for PTRH2 Antibody (NBP1-88595)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PTRH2 |
![Immunocytochemistry/Immunofluorescence: PTRH2 Antibody [NBP1-88595] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.](http://images.novusbio.com/fullsize/PTRH2-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-88595-img0006.jpg "Immunocytochemistry/Immunofluorescence: PTRH2 Antibody [NBP1-88595] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.")
![Immunohistochemistry-Paraffin: PTRH2 Antibody [NBP1-88595] - Staining of human testis shows strong granular cytoplasmic positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/PTRH2-Antibody-Immunohistochemistry-Paraffin-NBP1-88595-img0011.jpg "Immunohistochemistry-Paraffin: PTRH2 Antibody [NBP1-88595] - Staining of human testis shows strong granular cytoplasmic positivity in cells in seminiferous ducts.")
![Immunohistochemistry-Paraffin: PTRH2 Antibody [NBP1-88595] - Staining of human epididymis shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/PTRH2-Antibody-Immunohistochemistry-Paraffin-NBP1-88595-img0007.jpg "Immunohistochemistry-Paraffin: PTRH2 Antibody [NBP1-88595] - Staining of human epididymis shows strong cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: PTRH2 Antibody [NBP1-88595] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.](http://images.novusbio.com/fullsize/PTRH2-Antibody-Immunohistochemistry-Paraffin-NBP1-88595-img0008.jpg "Immunohistochemistry-Paraffin: PTRH2 Antibody [NBP1-88595] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.")
![Immunohistochemistry-Paraffin: PTRH2 Antibody [NBP1-88595] - Staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.](http://images.novusbio.com/fullsize/PTRH2-Antibody-Immunohistochemistry-Paraffin-NBP1-88595-img0009.jpg "Immunohistochemistry-Paraffin: PTRH2 Antibody [NBP1-88595] - Staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.")
![Immunohistochemistry-Paraffin: PTRH2 Antibody [NBP1-88595] - Staining of human small intestine shows strong granular cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/PTRH2-Antibody-Immunohistochemistry-Paraffin-NBP1-88595-img0010.jpg "Immunohistochemistry-Paraffin: PTRH2 Antibody [NBP1-88595] - Staining of human small intestine shows strong granular cytoplasmic positivity in glandular cells.")
![Immunohistochemistry PTHLH/PTHrP Antibody (677939) [Unconjugated]](https://images.novusbio.com/images2/PTHLH_MAB6734_Immunohistochemistry_10816.jpg)
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")