![Western Blot: PSMC1 Antibody [NBP1-91476] - Lane 1: 10 ug proteasome fraction from C57B1/6J mouse brain, lane 2: 10 ug proteasome fraction from BLAB/C mouse brain. Primary PSMC1 antibody at 1:500. Secondary antibody: Anti-rabbit HRP antibody at 1:5000.](http://images.novusbio.com/fullsize/PSMC1-Antibody-Western-Blot-NBP1-91476-img0003.jpg "Western Blot: PSMC1 Antibody [NBP1-91476] - Lane 1: 10 ug proteasome fraction from C57B1/6J mouse brain, lane 2: 10 ug proteasome fraction from BLAB/C mouse brain. Primary PSMC1 antibody at 1:500. Secondary antibody: Anti-rabbit HRP antibody at 1:5000.")
| Reactivity | MuSpecies Glossary |
| Applications | WB, Simple Western |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Concentration | 0.5 mg/ml |
| Description | The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
| Immunogen | Synthetic peptide corresponding to a region of Mouse Psmc1 (NP_032973). Peptide sequence ELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDG. The peptide sequence for this immunogen was taken from within the described region. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PSMC1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | This PSMC1 antibody is validated for Simple Western from a verified customer review. |
|
| Theoretical MW | 48 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
|
| Reviewed Applications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
| Images | Ratings | Applications | Species | Date | Details | ||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Verified Customer |
Simple Western | Mouse | 08/23/2019 |
Summary
|
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
5 | |
4 | |
3 | |
2 | |
1 |
| Verified Customer 08/23/2019 |
||
| Application: | Simple Western | |
| Species: | Mouse |
![Western Blot: PSMC1 Antibody [NBP1-91476] - Mouse Brain lysate, PSMC1 antibody a 1 ug/mL.](http://images.novusbio.com/fullsize/PSMC1-Antibody-Western-Blot-NBP1-91476-img0002.jpg "Western Blot: PSMC1 Antibody [NBP1-91476] - Mouse Brain lysate, PSMC1 antibody a 1 ug/mL.")
![Simple Western: PSMC1 Antibody [NBP1-91476] - Mouse whole spleen lysates at the indicated concentrations were probed with a 1:25 dilution of this PSMC1 antibody. Simple Western image submitted by a verified customer review.](http://images.novusbio.com/fullsize/PSMC1-Antibody-Simple-Western-NBP1-91476-img0004.jpg "Simple Western: PSMC1 Antibody [NBP1-91476] - Mouse whole spleen lysates at the indicated concentrations were probed with a 1:25 dilution of this PSMC1 antibody. Simple Western image submitted by a verified customer review.")
![Immunocytochemistry Lck [p Tyr394] Antibody (755103)](https://images.novusbio.com/images2/Lck_MAB7500_Immunocytochemistry_12319.jpg)
![Western Blot Lck [p Tyr394] Antibody (755103)](https://images.novusbio.com/images2/Lck_MAB7500_Western_Blot_12455.jpg)
![Bioactivity IL-2 [Unconjugated]](https://images.novusbio.com/images/202-il_recombinant-human-il-2-protein-bioactivity-174202314946.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
