Home » Prolyl Oligopeptidase/PREP » PREP Peptides and Proteins » Prolyl Oligopeptidase/PREP Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Prolyl Oligopeptidase/PREP Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Prolyl Oligopeptidase/PREP Protein (NBP2-33950PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Prolyl Oligopeptidase/PREP Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PREP.

Source: E. coli

Amino Acid Sequence: LSIREGCDPVNRLWYCDLQQESSGIAGILKWVKLIDNFEGEYDYVTNEGTVFTFKTNRQSPNYRVINIDFRDPEESKWKVLVPEHEKD

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PREP
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-33950.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Prolyl Oligopeptidase/PREP Recombinant Protein Antigen

  • dJ355L5.1 (prolyl endopeptidase)
  • EC 3.4.21.26
  • MGC16060
  • PE
  • PEP
  • Post-proline cleaving enzyme
  • PREP
  • prolyl endopeptidase
  • Prolyl Oligopeptidase
  • rPop

Background

The protein encoded by the Prolyl Endopeptidase gene is a cytosolic prolyl endopeptidase that cleaves peptide bonds on the C-terminal side of prolyl residues within peptides that are up to approximately 30 amino acids long. Prolyl endopeptidases have been reported to be involved in the maturation and degradation of peptide hormones and neuropeptides. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Recombinant Human
PRH2 GST (N-Term) Pro ...
H00005555-P01
SDS-PAGE Recombinant Human PRH2 GST (N-Term) Protein
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Pancreatic Amylase
Alpha Antibody (OTI6D ...
NBP1-47659
Immunohistochemistry-Paraffin Pancreatic Amylase Alpha Antibody (OTI6D4)
Immunohistochemistry-Paraffin Pancreatic Amylase Alpha Antibody (OTI6D4)
Immunohistochemistry-Paraffin Pancreatic Amylase Alpha Antibody (OTI6D4)
(1 Review)
Species: Hu
Applications: IHC, IHC-P, WB
EPB42 Antibody
(2G12)
H00002038-M01
Western Blot EPB42 Antibody (2G12)
ELISA EPB42 Antibody (2G12)
Immunocytochemistry/ Immunofluorescence EPB42 Antibody (2G12)
Species: Hu
Applications: ELISA, ICC/IF, WB
Recombinant Human
PRH1 His Protein
NBP2-23368
SDS-PAGE Recombinant Human PRH1 His Protein
Species: Hu
Applications: PAGE
Pallidin Antibody
(OTI1H9)
NBP2-01763
Western Blot Pallidin Antibody (OTI1H9)
Flow Cytometry Pallidin Antibody (OTI1H9)
Immunohistochemistry-Paraffin Pallidin Antibody (OTI1H9)
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
DPPIV/CD26
Antibody [Unconjugate
AF1180
Simple Western DPPIV/CD26 Antibody [Unconjugated]
Immunohistochemistry DPPIV/CD26 Antibody [Unconjugated]
Immunocytochemistry DPPIV/CD26 Antibody [Unconjugated]
(2 Reviews)
(56 Publications)
Species: Hu
Applications: ICC, IHC, Simple Western, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(817 Publications)
Species: Hu
Applications: BA
Serpin
A8/Angiotensinogen An ...
NBP1-30027
Immunohistochemistry-Paraffin Serpin A8/Angiotensinogen Antibody - BSA Free
Western Blot Serpin A8/Angiotensinogen Antibody - BSA Free
Immunohistochemistry-Paraffin Serpin A8/Angiotensinogen Antibody - BSA Free
(11 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
PLA2G1B Antibody
(630823)
MAB5018
Western Blot PLA2G1B Antibody (630823)
Species: Hu
Applications: IP, WB
Glutaminyl-peptide
Cyclotransferase/QPCT ...
NBP1-81838
Western Blot Glutaminyl-peptide Cyclotransferase/QPCT Antibody
Immunohistochemistry Glutaminyl-peptide Cyclotransferase/QPCT Antibody
Immunohistochemistry-Paraffin Glutaminyl-peptide Cyclotransferase/QPCT Antibody
(1 Publication)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Albumin Antibody
(188835) [Unconjugate ...
MAB1455
Simple Western Albumin Antibody (188835) [Unconjugated] - Serum
Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum
Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum
(3 Reviews)
(54 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Phospholipase B1
Antibody (C4)
NBP3-41952
Immunohistochemistry-Paraffin Phospholipase B1 Antibody (C4)
Species: Hu, Po
Applications: ICC/IF, IHC, WB
Thyrotropin
Releasing Hormone Ant
NBP2-34014
Immunohistochemistry-Paraffin Thyrotropin Releasing Hormone Antibody
Immunohistochemistry-Paraffin Thyrotropin Releasing Hormone Antibody
Immunohistochemistry-Paraffin Thyrotropin Releasing Hormone Antibody
Species: Hu
Applications: IHC, IHC-P
IL-6 [HRP]
M6000B
N/A IL-6 [HRP]
N/A IL-6 [HRP]
N/A IL-6 [HRP]
(663 Publications)
Species: Mu
Applications: ELISA
Placental
Lactogen/CSH1 Antibod ...
NBP2-46376
Immunohistochemistry Placental Lactogen/CSH1 Antibody (OTI2G4)
Immunohistochemistry Placental Lactogen/CSH1 Antibody (OTI2G4)
Immunohistochemistry Placental Lactogen/CSH1 Antibody (OTI2G4)
Species: Hu
Applications: IHC, IHC-P, WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(24 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
14-3-3 zeta
Antibody (818515) [Un ...
MAB2669
Simple Western 14-3-3 zeta Antibody (818515) [Unconjugated]
Western Blot 14-3-3 zeta Antibody (818515) [Unconjugated]
Immunohistochemistry 14-3-3 zeta Antibody (818515) [Unconjugated]
(2 Reviews)
(1 Publication)
Species: Hu
Applications: IHC, Simple Western, WB
Pancreatic Lipase
Antibody
NBP2-38958
Immunohistochemistry-Paraffin Pancreatic Lipase Antibody
Immunohistochemistry-Paraffin Pancreatic Lipase Antibody
Immunohistochemistry-Paraffin Pancreatic Lipase Antibody
Species: Hu
Applications: IHC, IHC-P

Publications for Prolyl Oligopeptidase/PREP Protein (NBP2-33950PEP) (0)

There are no publications for Prolyl Oligopeptidase/PREP Protein (NBP2-33950PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Prolyl Oligopeptidase/PREP Protein (NBP2-33950PEP) (0)

There are no reviews for Prolyl Oligopeptidase/PREP Protein (NBP2-33950PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Prolyl Oligopeptidase/PREP Protein (NBP2-33950PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Prolyl Oligopeptidase/PREP Products

Blogs on Prolyl Oligopeptidase/PREP

There are no specific blogs for Prolyl Oligopeptidase/PREP, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Prolyl Oligopeptidase/PREP Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol PREP