Prolyl endopeptidase-like Antibody Summary
Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Prolyl endopeptidase-like (NP_666096). Peptide sequence LRAVTLEAPFLDVLNTMLDTTLPLTLEELEEWGNPSSDEKHKNYIKRYCP |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
PREPL |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
|
Theoretical MW |
50 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS, 2% Sucrose |
Preservative |
0.09% Sodium Azide |
Concentration |
0.5 mg/ml |
Purity |
Affinity purified |
Alternate Names for Prolyl endopeptidase-like Antibody
Background
PREPL belongs to the prolyl oligopeptidase subfamily of serine peptidases (Parvari et al., 2005 [PubMed 15913950]).[supplied by OMIM]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: Flow, IHC, IHC-P, WB
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: ICC/IF
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, S-ELISA, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Am, Av, Fi, Ma, Ze
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: CyTOF-ready, Flow, IHC, WB
Species: Hu
Applications: ChIP, ICC/IF, IP, WB
Species: Al, Av, Hu, Mu, Pl, Rt, Ze
Applications: ChIP, Flow, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
Publications for Prolyl endopeptidase-like Antibody (NBP3-09439) (0)
There are no publications for Prolyl endopeptidase-like Antibody (NBP3-09439).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Prolyl endopeptidase-like Antibody (NBP3-09439) (0)
There are no reviews for Prolyl endopeptidase-like Antibody (NBP3-09439).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Prolyl endopeptidase-like Antibody (NBP3-09439) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Prolyl endopeptidase-like Products
Research Areas for Prolyl endopeptidase-like Antibody (NBP3-09439)
Find related products by research area.
|
Blogs on Prolyl endopeptidase-like