![Western Blot: PITRM1 Antibody [NBP1-81729] - Analysis using Anti-PITRM1 antibody NBP1-81729 (A) shows similar pattern to independent antibody NBP1-81728 (B).](http://images.novusbio.com/fullsize/PITRM1-Antibody-Western-Blot-NBP1-81729-img0012.jpg "Western Blot: PITRM1 Antibody [NBP1-81729] - Analysis using Anti-PITRM1 antibody NBP1-81729 (A) shows similar pattern to independent antibody NBP1-81728 (B).")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: ELRSQQSKPQDASCLPALKVSDIEPTIPVTELDVVLTAGDIPVQYCAQPTNGMVYFRAFSSLNTLPEELRPYVPLFCSVLTKLGCGLLDYREQAQQIELKTGGMSASPHVLPDDSHMDTYEQGVLFSSLCLDRNLPDMMQLWSEI |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PITRM1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PITRM1 |
![Immunocytochemistry/Immunofluorescence: PITRM1 Antibody [NBP1-81729] - Staining of human cell line U-251 MG shows localization to mitochondria.](http://images.novusbio.com/fullsize/PITRM1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-81729-img0010.jpg "Immunocytochemistry/Immunofluorescence: PITRM1 Antibody [NBP1-81729] - Staining of human cell line U-251 MG shows localization to mitochondria.")
![Immunohistochemistry-Paraffin: PITRM1 Antibody [NBP1-81729] - Staining of human cerebral cortex.](http://images.novusbio.com/fullsize/PITRM1-Antibody-Immunohistochemistry-Paraffin-NBP1-81729-img0015.jpg "Immunohistochemistry-Paraffin: PITRM1 Antibody [NBP1-81729] - Staining of human cerebral cortex.")
![Western Blot: PITRM1 Antibody [NBP1-81729] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp](http://images.novusbio.com/fullsize/PITRM1-Antibody-Western-Blot-NBP1-81729-img0005.jpg "Western Blot: PITRM1 Antibody [NBP1-81729] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp")
![Immunohistochemistry-Paraffin: PITRM1 Antibody [NBP1-81729] - Staining of human heart muscle shows strong cytoplasmic positivity in myocytes.](http://images.novusbio.com/fullsize/PITRM1-Antibody-Immunohistochemistry-Paraffin-NBP1-81729-img0002.jpg "Immunohistochemistry-Paraffin: PITRM1 Antibody [NBP1-81729] - Staining of human heart muscle shows strong cytoplasmic positivity in myocytes.")
![Immunohistochemistry-Paraffin: PITRM1 Antibody [NBP1-81729] - Staining of human salivary gland shows low expression as expected.](http://images.novusbio.com/fullsize/PITRM1-Antibody-Immunohistochemistry-Paraffin-NBP1-81729-img0007.jpg "Immunohistochemistry-Paraffin: PITRM1 Antibody [NBP1-81729] - Staining of human salivary gland shows low expression as expected.")
![Immunohistochemistry-Paraffin: PITRM1 Antibody [NBP1-81729] - Staining of human testis shows high expression.](http://images.novusbio.com/fullsize/PITRM1-Antibody-Immunohistochemistry-Paraffin-NBP1-81729-img0008.jpg "Immunohistochemistry-Paraffin: PITRM1 Antibody [NBP1-81729] - Staining of human testis shows high expression.")
![Immunohistochemistry-Paraffin: PITRM1 Antibody [NBP1-81729] - Staining in human testis and salivary gland tissues using anti-PITRM1 antibody. Corresponding PITRM1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/PITRM1-Antibody-Immunohistochemistry-Paraffin-NBP1-81729-img0009.jpg "Immunohistochemistry-Paraffin: PITRM1 Antibody [NBP1-81729] - Staining in human testis and salivary gland tissues using anti-PITRM1 antibody. Corresponding PITRM1 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: PITRM1 Antibody [NBP1-81729] - Staining of human cerebral cortex, colon, heart muscle and testis using Anti-PITRM1 antibody NBP1-81729 (A) shows similar protein distribution across tissues to independent antibody NBP1-81728 (B).](http://images.novusbio.com/fullsize/PITRM1-Antibody-Immunohistochemistry-Paraffin-NBP1-81729-img0011.jpg "Immunohistochemistry-Paraffin: PITRM1 Antibody [NBP1-81729] - Staining of human cerebral cortex, colon, heart muscle and testis using Anti-PITRM1 antibody NBP1-81729 (A) shows similar protein distribution across tissues to independent antibody NBP1-81728 (B).")
![Immunohistochemistry-Paraffin: PITRM1 Antibody [NBP1-81729] - Staining of human heart muscle.](http://images.novusbio.com/fullsize/PITRM1-Antibody-Immunohistochemistry-Paraffin-NBP1-81729-img0013.jpg "Immunohistochemistry-Paraffin: PITRM1 Antibody [NBP1-81729] - Staining of human heart muscle.")
![Immunohistochemistry-Paraffin: PITRM1 Antibody [NBP1-81729] - Staining of human colon.](http://images.novusbio.com/fullsize/PITRM1-Antibody-Immunohistochemistry-Paraffin-NBP1-81729-img0014.jpg "Immunohistochemistry-Paraffin: PITRM1 Antibody [NBP1-81729] - Staining of human colon.")
![Western Blot Prostatic Acid Phosphatase/ACPP Antibody [Unconjugated]](https://images.novusbio.com/images2/Prostatic_Acid_Phosphatase_AF6240_Western_Blot_10680.jpg)
![Immunohistochemistry Prostatic Acid Phosphatase/ACPP Antibody [Unconjugated]](https://images.novusbio.com/images2/Prostatic_Acid_Phosphatase_AF6240_Immunohistochemistry_10732.jpg)
![ELISA Prostatic Acid Phosphatase/ACPP Antibody [Unconjugated]](https://images.novusbio.com/images2/Prostatic_Acid_Phosphatase_AF6240_ELISA_22233.jpg)
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![Immunocytochemistry S100A9 Antibody [Unconjugated]](https://images.novusbio.com/images2/S100A9_AF2065_Immunocytochemistry_6480.jpg)
![Immunohistochemistry S100A9 Antibody [Unconjugated]](https://images.novusbio.com/images2/S100A9_AF2065_Immunohistochemistry_22376.jpg)
![Immunocytochemistry S100A9 Antibody [Unconjugated]](https://images.novusbio.com/images2/S100A9_AF2065_Immunocytochemistry__Immunofluorescence_22492.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")