![Immunohistochemistry-Paraffin: Profilin 2 Antibody [NBP1-87426] - Staining in human cerebral cortex and skin tissues using anti-PFN2 antibody. Corresponding PFN2 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Profilin-2-Antibody-Immunohistochemistry-Paraffin-NBP1-87426-img0012.jpg "Immunohistochemistry-Paraffin: Profilin 2 Antibody [NBP1-87426] - Staining in human cerebral cortex and skin tissues using anti-PFN2 antibody. Corresponding PFN2 RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: QEAAIVGYCDAKYVWAATAGGVFQSITPIEIDMIVGKDREGFFTNGLTLGAKKCSVIRD |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PFN2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Profilin 2 antibody validated for ICC from a verified customer review. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Images | Ratings | Applications | Species | Date | Details | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Verified Customer |
ICC | Mouse | 01/10/2019 |
Summary
Comments
|
Secondary Antibodies |
Isotype Controls |
Research Areas for Profilin 2 Antibody (NBP1-87426)Find related products by research area.
|
|
Profiling the Profilin 1 Antibody Profilin-1, or Pfn-1, is a small actin-binding protein which plays an essential role controlling the growth of microfilaments. Profilin 1 and Profilin 2 have similar biochemical properties but are expressed in different tissues. The Profilin 1 antibod... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PFN2 |
![Western Blot: Profilin 2 Antibody [NBP1-87426] - Analysis in human cell lines A-431 and Caco-2. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-PARP1.](http://images.novusbio.com/fullsize/Profilin-2-Antibody-Western-Blot-NBP1-87426-img0009.jpg "Western Blot: Profilin 2 Antibody [NBP1-87426] - Analysis in human cell lines A-431 and Caco-2. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-PARP1.")
![Western Blot: Profilin 2 Antibody [NBP1-87426] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).](http://images.novusbio.com/fullsize/Profilin-2-Antibody-Western-Blot-NBP1-87426-img0006.jpg "Western Blot: Profilin 2 Antibody [NBP1-87426] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).")
![Western Blot: Profilin 2 Antibody [NBP1-87426] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp](http://images.novusbio.com/fullsize/Profilin-2-Antibody-Western-Blot-NBP1-87426-img0007.jpg "Western Blot: Profilin 2 Antibody [NBP1-87426] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp")
![Immunohistochemistry-Paraffin: Profilin 2 Antibody [NBP1-87426] - Staining of human cerebral cortex shows high expression.](http://images.novusbio.com/fullsize/Profilin-2-Antibody-Immunohistochemistry-Paraffin-NBP1-87426-img0010.jpg "Immunohistochemistry-Paraffin: Profilin 2 Antibody [NBP1-87426] - Staining of human cerebral cortex shows high expression.")
![Immunohistochemistry-Paraffin: Profilin 2 Antibody [NBP1-87426] - Staining of human skin shows low expression as expected.](http://images.novusbio.com/fullsize/Profilin-2-Antibody-Immunohistochemistry-Paraffin-NBP1-87426-img0011.jpg "Immunohistochemistry-Paraffin: Profilin 2 Antibody [NBP1-87426] - Staining of human skin shows low expression as expected.")
![N/A BDNF [HRP]](https://images.novusbio.com/images2/DATA_BDNF_DBD00_ELISA_587.jpg)
![N/A BDNF [HRP]](https://images.novusbio.com/images2/DATA_BDNF_DBD00_ELISA_588.jpg)
![N/A BDNF [HRP]](https://images.novusbio.com/images2/BDNF_DBD00_ELISA_36.jpg)
![Western Blot Angiopoietin-like Protein 2/ANGPTL2 Antibody [Unconjugated]](https://images.novusbio.com/images2/Angiopoietinlike_Protein_2_AF1444_Western_Blot_19840.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
