Home » PRAME » PRAME Proteins » PRAME Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

PRAME Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for PRAME Recombinant Protein Antigen (NBP2-61148PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals offers 100% Guarantee

PRAME Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PRAME.

Source: E. coli

Amino Acid Sequence: LLLSHIHASSYISPEKEEQYIAQFTSQFLSLQCLQALYVDSLFFLRGRLDQLLRHVMNPLETLSITNCRLSEGDVMHLSQSPSVSQLSVLSLSGVMLTDVSPEPLQALLERASATLQDLVFDECGI

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PRAME
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-61148.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PRAME Recombinant Protein Antigen

  • cancer/testis antigen 130
  • MAPEOIP4CT130
  • melanoma antigen preferentially expressed in tumors
  • OIP-4
  • Opa-interacting protein 4
  • Opa-interacting protein OIP4
  • preferentially expressed antigen in melanoma
  • Preferentially expressed antigen of melanoma

Background

PRAME encodes an antigen that is predominantly expressed in human melanomas and that is recognized by cytolytic T lymphocytes. It is not expressed in normal tissues, except testis. This expression pattern is similar to that of other CT antigens, such as MAGE, BAGE and GAGE. However, unlike these other CT antigens, this gene is also expressed in acute leukemias. Recent data from Epping et.al., (Cell, Vol. 122: 835) suggest that overexpression of PRAME frequently observed in human cancers confers growth or survival advantages by antagonizing RAR signaling.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

RHAMM/CD168
Antibody - BSA Free
NBP1-76538
Flow Cytometry RHAMM/CD168 Antibody - BSA Free
Western Blot RHAMM/CD168 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence RHAMM/CD168 Antibody - BSA Free
(1 Review)
(3 Publications)
Species: Hu, Mu, Po, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
CTAG1B Antibody
(OTI2B6)
NBP1-47714
Immunocytochemistry/ Immunofluorescence CTAG1B Antibody (OTI2B6)
Flow Cytometry CTAG1B Antibody (OTI2B6)
Flow Cytometry CTAG1B Antibody (OTI2B6)
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
WT1 Antibody
(6F-H2) - BSA Free
NB110-60011
Western Blot WT1 Antibody (6F-H2) - BSA Free
Immunohistochemistry-Paraffin WT1 Antibody (6F-H2) - BSA Free
Western Blot WT1 Antibody (6F-H2) - BSA Free
(3 Reviews)
(16 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
HSP27 [p Ser78, p
Ser82, p Ser82] Antib ...
AF2314
Western Blot HSP27 [p Ser78, p Ser82, p Ser82] Antibody [Unconjugated]
Immunocytochemistry HSP27 [p Ser78, p Ser82, p Ser82] Antibody [Unconjugated]
Western Blot HSP27 [p Ser78, p Ser82, p Ser82] Antibody [Unconjugated]
(4 Publications)
Species: Hu, Mu, Rt
Applications: ICC, WB
p21/CIP1/CDKN1A
Antibody (WA-1)
NBP2-29463
Immunohistochemistry-Paraffin p21/CIP1/CDKN1A Antibody (WA-1)
(24 Publications)
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Proteinase
3/Myeloblastin/PRTN3 ...
NBP1-25966
Western Blot Proteinase 3/Myeloblastin/PRTN3 Antibody
Immunocytochemistry/ Immunofluorescence Proteinase 3/Myeloblastin/PRTN3 Antibody
Immunocytochemistry/ Immunofluorescence Proteinase 3/Myeloblastin/PRTN3 Antibody
(2 Publications)
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Melan-A/MART-1
Antibody (A19-P)
NBP1-30151
Immunohistochemistry-Paraffin Melan-A/MART-1 Antibody (A19-P)
Immunohistochemistry-Paraffin Melan-A/MART-1 Antibody (A19-P)
(4 Reviews)
(22 Publications)
Species: Ca, Hu, Mu
Applications: ICC/IF, IHC, IHC-P
HLA ABC Antibody
(W6/32) - Azide and B ...
NB100-64775
Flow Cytometry HLA ABC Antibody (W6/32) - Azide and BSA Free
Flow Cytometry HLA ABC Antibody (W6/32) - Azide and BSA Free
Immunohistochemistry-Frozen HLA ABC Antibody (W6/32) - Azide and BSA Free
(2 Reviews)
(32 Publications)
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, Func, IHC, IHC-Fr, IHC-P (-), IP
Recombinant Human
HLA DRB4 GST (N-Term) ...
H00003126-P01
Other Recombinant Human HLA DRB4 GST (N-Term) Protein
(1 Publication)
Species: Hu
Applications: ELISA, AP, PA, WB
Carbonic Anhydrase
IX/CA9 Antibody - BSA ...
NB100-417
Flow Cytometry Carbonic Anhydrase IX/CA9 Antibody - BSA Free
Immunoblotting Carbonic Anhydrase IX/CA9 Antibody - BSA Free
Immunoblotting Carbonic Anhydrase IX/CA9 Antibody - BSA Free
(7 Reviews)
(292 Publications)
Species: Hu, Mu, Pl, Rt
Applications: ChIP, Dual ISH-IHC, ELISA, Flow, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, MiAr, PLA, Simple Western, WB
CD34 Antibody (MEC
14.7) - BSA Free
NB600-1071
Flow Cytometry CD34 Antibody (MEC 14.7) - BSA Free
Flow Cytometry CD34 Antibody (MEC 14.7) - BSA Free
Immunocytochemistry/ Immunofluorescence CD34 Antibody (MEC 14.7) - BSA Free
(29 Publications)
Species: Hu(-), Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, mIF, WB
CTAG2 Antibody -
BSA Free
NBP2-49659
Immunohistochemistry-Paraffin CTAG2 Antibody - BSA Free
Immunohistochemistry-Paraffin CTAG2 Antibody - BSA Free
Immunohistochemistry-Paraffin CTAG2 Antibody - BSA Free
Species: Hu
Applications: IHC, IHC-P
Survivin Antibody
- BSA Free
NB500-201
Flow Cytometry Survivin Antibody - BSA Free
Dual RNAscope ISH-IHC Survivin Antibody - BSA Free
Knockdown Validated Survivin Antibody - BSA Free
(22 Reviews)
(379 Publications)
Species: Ca, Fe, Gp, Ha, Hu, Mu, Rt
Applications: ChIP, Dual ISH-IHC, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, Simple Western, WB
Flt-3/Flk-2/CD135
Antibody (66903) [Unc ...
MAB812
Flow Cytometry Flt-3/Flk-2/CD135 Antibody (66903) [Unconjugated]
Flow Cytometry Flt-3/Flk-2/CD135 Antibody (66903) [Unconjugated]
(4 Publications)
Species: Hu
Applications: CyTOF-ready, Flow
PAK3 Antibody
[Unconjugated]
AF6897
Western Blot PAK3 Antibody [Unconjugated]
Immunohistochemistry PAK3 Antibody [Unconjugated]
Immunohistochemistry PAK3 Antibody [Unconjugated]
Species: Hu, Mu
Applications: IHC, Simple Western, WB
S100A4 Antibody
(1F12-1G7) - Azide an ...
H00006275-M01
Western Blot S100A4 Antibody (1F12-1G7) - Azide and BSA Free
Western Blot S100A4 Antibody (1F12-1G7) - Azide and BSA Free
ELISA S100A4 Antibody (1F12-1G7) - Azide and BSA Free
(17 Publications)
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, WB

Publications for PRAME Recombinant Protein Antigen (NBP2-61148PEP) (0)

There are no publications for PRAME Recombinant Protein Antigen (NBP2-61148PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PRAME Recombinant Protein Antigen (NBP2-61148PEP) (0)

There are no reviews for PRAME Recombinant Protein Antigen (NBP2-61148PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PRAME Recombinant Protein Antigen (NBP2-61148PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PRAME Products

Research Areas for PRAME Recombinant Protein Antigen (NBP2-61148PEP)

Find related products by research area.

Blogs on PRAME

There are no specific blogs for PRAME, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Flow Cytometry: Survivin Antibody [NB500-201] - An intracellular stain was performed on HeLa cells with [NB500-201] and a matched isotype control. Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature, followed by Rabbit IgG (H+L) Cross-Adsorbed Secondary Antibody, Dylight 550.
Survivin Antibody - BSA Free
NB500-201
An intracellular stain was performed on U-87 MG Cells with NB100-417 and a matched isotype control. Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature, followed by Rabbit IgG APC-conjugated Secondary Antibody, (R&D Systems, F0111).
Carbonic Anhydrase IX/CA9 Antibody - BSA Free
NB100-417

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PRAME Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol PRAME