Home » PRAM1 » PRAM1 Proteins » PRAM1 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

PRAM1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for PRAM1 Recombinant Protein Antigen (NBP2-55280PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

PRAM1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PRAM1.

Source: E. coli

Amino Acid Sequence: QLPPMDPKLLKQLRKAEKAEREFRKKFKFEGEIVVHTKMMIDPNAKTRRGGGKHLGIRRGEILEVIEFTSNEEMLCRDPKGKYGYVP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PRAM1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55280.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PRAM1 Recombinant Protein Antigen

  • MGC39864
  • PML-RAR
  • PML-RARA regulated adaptor molecule 1
  • PML-RARA target gene encoding an Adaptor Molecule-1
  • PML-RARA-regulated adapter molecule 1
  • PRAM
  • PRAM-1

Background

PRAM1 is encoded by this gene is similar to FYN binding protein (FYB/SLAP-130), an adaptor protein involved in T cell receptor mediated signaling. This gene is expressed and regulated during normal myelopoiesis. The expression of this gene is induced by retinoic acid and is inhibited by the expression of PML-RARalpha, a fusion protein of promyelocytic leukemia (PML) and the retinoic acid receptor-alpha (RARalpha).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

PML Protein
Antibody - BSA Free
NB100-59787
Western Blot PML Protein Antibody - BSA Free
Immunohistochemistry PML Protein Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence PML Protein Antibody - BSA Free
(1 Review)
(42 Publications)
Species: Hu, Mu
Applications: Flow, IB, ICC/IF, IHC, IHC-P, IP, KD, PLA, WB
RAR alpha/NR1B1
Antibody (763)
NB200-322
Western Blot RAR alpha/NR1B1 Antibody (763)
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, WB
Recombinant Human
RAB40B GST (N-Term) P ...
H00010966-P01
Other Recombinant Human RAB40B GST (N-Term) Protein
Species: Hu
Applications: ELISA, AP, PA, WB
Flt-3/Flk-2/CD135
Antibody (66903) [Unc ...
MAB812
Flow Cytometry Flt-3/Flk-2/CD135 Antibody (66903) [Unconjugated]
Flow Cytometry Flt-3/Flk-2/CD135 Antibody (66903) [Unconjugated]
(4 Publications)
Species: Hu
Applications: CyTOF-ready, Flow
PLZF Antibody
[Unconjugated]
AF2944
Western Blot PLZF Antibody [Unconjugated]
Simple Western PLZF Antibody [Unconjugated]
Western Blot PLZF Antibody [Unconjugated]
(45 Publications)
Species: Hu
Applications: Simple Western, WB
NCOR1 Antibody
(7A7A9) - BSA Free
NBP1-28863
Immunohistochemistry-Paraffin NCOR1 Antibody (7A7A9) - BSA Free
Immunohistochemistry NCOR1 Antibody (7A7A9) - BSA Free
Western Blot NCOR1 Antibody (7A7A9) - BSA Free
(3 Publications)
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NPM1 Antibody -
BSA Free
NB110-61646
Immunocytochemistry/ Immunofluorescence NPM1 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence NPM1 Antibody - BSA Free
Western Blot NPM1 Antibody - BSA Free
(2 Reviews)
(4 Publications)
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
BCR Antibody
AF5129
Western Blot BCR Antibody
(1 Publication)
Species: Hu
Applications: WB
c-Abl Antibody
[Unconjugated]
AF5414
Western Blot c-Abl Antibody [Unconjugated]
Simple Western c-Abl Antibody [Unconjugated]
(1 Publication)
Species: Hu
Applications: Simple Western, WB
CD11b Antibody -
BSA Free
NB110-89474
Immunocytochemistry/ Immunofluorescence CD11b Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence CD11b Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence CD11b Antibody - BSA Free
(12 Reviews)
(114 Publications)
Species: Bv, Ce, ChHa, Hu, Pm, Mu, Rt, RM
Applications: Dual ISH-IHC, Flow-CS, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, ISH, Simple Western, Single-Cell Western, WB
NCOR2 Antibody
NB120-5802
Immunocytochemistry/ Immunofluorescence NCOR2 Antibody
Immunocytochemistry/ Immunofluorescence NCOR2 Antibody
Immunocytochemistry/ Immunofluorescence NCOR2 Antibody
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(817 Publications)
Species: Hu
Applications: BA
NOD2 Antibody
(2D9) - BSA Free
NB100-524
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Immunohistochemistry-Frozen NOD2 Antibody (2D9) - BSA Free
(1 Review)
(26 Publications)
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
HLA DQ/DR/DP
Antibody (HLA-Pan/296 ...
NBP2-79843
Protein Array HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Western Blot HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
MTTP Antibody
NBP1-62489
Western Blot MTTP Antibody
Western Blot MTTP Antibody
(1 Review)
(1 Publication)
Species: Dr, Hu, Mu
Applications: WB
CTLA-4
[Unconjugated]
7268-CT
Bioactivity CTLA-4 [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
RUNX1/CBFA2
Antibody
NBP1-89105
Immunocytochemistry/ Immunofluorescence RUNX1/CBFA2 Antibody
Immunohistochemistry-Paraffin RUNX1/CBFA2 Antibody
Immunohistochemistry-Paraffin RUNX1/CBFA2 Antibody
(1 Review)
(2 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
FYB/ADAP/SLAP130
Antibody [Unconjugate ...
AF3857
Western Blot FYB/ADAP/SLAP130 Antibody [Unconjugated]
Species: Hu
Applications: WB
MID1 Antibody
NBP1-26612
Western Blot MID1 Antibody
(2 Publications)
Species: Hu
Applications: IP (-), WB
PRAM1 Recombinant
Protein Antigen
NBP2-55280PEP
PRAM1 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for PRAM1 Recombinant Protein Antigen (NBP2-55280PEP) (0)

There are no publications for PRAM1 Recombinant Protein Antigen (NBP2-55280PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PRAM1 Recombinant Protein Antigen (NBP2-55280PEP) (0)

There are no reviews for PRAM1 Recombinant Protein Antigen (NBP2-55280PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PRAM1 Recombinant Protein Antigen (NBP2-55280PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PRAM1 Products

Blogs on PRAM1

There are no specific blogs for PRAM1, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005
Immunocytochemistry/Immunofluorescence: CD11b Antibody - BSA Free [NB110-89474] - Raw264.7 cells were fixed in 4% paraformaldehyde for 10 minutes and permeabilized in 0.05% Triton X-100 in PBS for 5 minutes. The cells were incubated with CD11b Antibody conjugated to Alexa Fluor 488 (NB110-89474AF488) at 5 ug/ml for 1 hour at room temperature. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 100X objective and digitally deconvolved.
CD11b Antibody - BSA Free
NB110-89474

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PRAM1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol PRAM1